Search
Invitrogen
CD47 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 1
CD47 Antibody (PA5-78986) in WB
Western blot analysis of CD47 in Lane 1: human MCF-7 whole cell lysate, Lane 2: human SK-OV-3 whole cell lysate, Lane 3: human PANC-1 whole cell lysate using 50 µg (reducing conditions) per well. Electrophoresis was performed on 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours and protein was transferred to a nitrocellulose membrane at 150mA for 50-90 minutes. Sample was blocked with 5% Non-fat Milk/TBS for 1.5 hours at room temperature, incubated with CD47 polyclonal antibody (Product # PA5-78986) at a dilution... View More
Product Details
PA5-78986
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human CD47 (KSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHT).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human MCF-7 whole cell, human SK-OV-3 whole cell, human PANC-1 whole cell.
Target Information
CD47, known as integrin-associated protein (IAP), is a glycosylated transmembrane glycoprotein with five domains, expressed widely across hematopoietic cells like T and B cells, monocytes, platelets, and erythrocytes, as well as non-hematopoietic cells. It interacts with integrins such as CD51/CD61 and CD41/CD61, and serves as a receptor for thrombospondin, mediating bi-directional signaling that affects neural synaptic activity and macrophage phagocytosis. CD47 acts as a ligand for CD172a (SIRP alpha), an inhibitory receptor on macrophages, preventing phagocytosis of CD47-positive cells. This interaction influences cell migration, B cell adhesion, T cell activation, and neuronal development, particularly in synapse-rich brain and retina regions. It also modulates chondrocyte responses to mechanical signals. T cell expression of CD47 can lead to activation or apoptosis in the presence of thrombospondin. Monoclonal antibody stimulation of CD47 has been shown to induce CD4+CD25- suppressive activity and increase Foxp3 expression. CD47's role in membrane transport, signal transduction, and its broad tissue distribution highlight its significance in various physiological processes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: antigen identified by monoclonal antibody 1D8; Antigenic surface determinant protein OA3; CD47; CD47 antigen; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); CD47 glycoprotein; IAP; integrin associated protein; Integrin-associated protein; integrin-associated signal transducer; Leukocyte surface antigen CD47; Protein MER6; Rh-related antigen; sCD47; soluble CD 47; soluble CD47; unnamed protein product
Gene Aliases: CD47; IAP; MER6; OA3
UniProt ID: (Human) Q08722
Entrez Gene ID: (Human) 961
angiogenesis
positive regulation of immune system process
apoptotic process
inflammatory response
cell adhesion
integrin-mediated signaling pathway
positive regulation of cell proliferation
cell migration
positive regulation of cell-cell adhesion
regulation of interferon-gamma production
regulation of interleukin-10 production
regulation of interleukin-12 production
regulation of interleukin-6 production
regulation of tumor necrosis factor production
heterotypic cell-cell adhesion
regulation of nitric oxide biosynthetic process
positive regulation of inflammatory response
negative regulation of phagocytosis
positive regulation of phagocytosis
positive regulation of T cell activation
positive regulation of stress fiber assembly
regulation of Fc receptor mediated stimulatory signaling pathway
cellular response to interferon-gamma
cellular response to interleukin-1
cellular response to interleukin-12
cell-cell adhesion
ATP export
positive regulation of monocyte extravasation
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support