Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Cell Analysis
    • Antibodies
    • Mass Spectrometry
    • Cell Culture
    • Laboratory Instruments
    • Clinical and Diagnostics
    • Chromatography
    • Laboratory Equipment
    • Laboratory Supplies
    • Molecular Biology and Nucleic Acid Analysis
    • Sequence-Specific Nucleic Acid Products
    • See all product categories
  • Applications
    • Cell Culture and Transfection
    • Flow Cytometry
    • Cancer Research
    • Chromatography
    • Sequencing
    • PCR
    • Lab Solutions
    • Allergy Diagnostics
    • See all applications and techniques
  • Services
    • Cell Biology Services
    • Custom Services
    • Training Services
    • Lab Informatics Services
    • Financial and Leasing Services
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Food Safety Inspection Services
    • See all services
  • Help and Support
    • How to Order
    • Promotions and Online Offers
    • Contact Us
    • Change Location
    • Create a New Account
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
          • Primary Antibodies ›
          • CHK2 Antibodies

          Invitrogen

          CHK2 Polyclonal Antibody

          View all (77) CHK2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite CHK2 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (2)
          CHK2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          CHK2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          CHK2 Antibody (PA5-79041) in IHC (P)

          Immunohistochemistry analysis of CHK2 on paraffin-embedded human lung cancer tissue. Sample was incubated with CHK2 polyclonal antibody (Product# PA5-79041). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          CHK2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          CHK2 Antibody in Western Blot (WB)
          CHK2 Polyclonal Antibody

          Product Details

          PA5-79041

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human Chk2 (465-498aa KLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDL).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746157

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Spleen Tissue, Mouse Testis Tissue, SW620 whole cell. IHC: human lung cancer tissue.

          Target Information

          CHEK2 (CHK2) is a serine/threonine kinase and a component of the DNA damage checkpoint pathway. A mutation in CHK2 has been linked to cancer. CHK2 is activated by DNA damage and phosphorylates several modulators of cell cycle control including tumor suppressor proteins. In addition, Chk2 can phosphorylate BRCA1, allowing BRCA1 to restore survival after DNA damage. Chk2 is a putative tumor suppressor protein, with mutations in to the Chk2 gene linked to Li-Fraumeni syndrome, a familiar cancer usually associated with inherited mutations in TP53. Also, mutations in CHK2 are thought to confer a predisposition to sarcomas, breast cancer, and brain tumors.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: Cds1; Cds1 homolog; Checkpoint kinase 2; Checkpoint like protein CHK2; checkpoint-like protein CHK2; CHEK2; Chk2 (phospho T68); Chk2 (pThr68); CHK2 checkpoint homolog; CHK2 checkpoint homolog (S. pombe); Chk2 phospho; Chk2 phospho T68; Chk2-del2-12; Chk2-del2-3; Chk2-del4; Chk2-del7; Chk2-del9; Chk2-del9-12; Chk2-insX; Chk2-insZ; Chk2-iso1; Chk2-iso2; Chk2-sub3; contains FHA domain; del9; EC 2.7.11.1; HuCds 1; Hucds1; kinase Chk2; OTTHUMP00000199044; OTTHUMP00000199045; OTTHUMP00000199064; OTTHUMP00000199115; OTTHUMP00000199116; phospho Chk2 (T68); phospho Thr68 Chk2; protein kinase Chk2; Rad53 homolog; RP11-436C9.1; Serine/threonine protein kinase Chk2; Serine/threonine-protein kinase Chk2; unnamed protein product

          View more View less

          Gene Aliases: CDS1; CHEK2; CHK2; hCds1; HUCDS1; LFS2; PP1425; RAD53; TPDS4

          View more View less

          UniProt ID: (Human) O96017, (Mouse) Q9Z265

          View more View less

          Entrez Gene ID: (Human) 11200, (Mouse) 50883, (Rat) 114212

          View more View less

          Function(s)
          nucleotide binding protein kinase activity protein serine/threonine kinase activity protein binding ATP binding kinase activity transferase activity protein kinase binding ubiquitin protein ligase binding identical protein binding protein homodimerization activity metal ion binding protein serine kinase activity transferase activity, transferring phosphorus-containing groups non-receptor serine/threonine protein kinase
          Process(es)
          autophagosome assembly DNA damage checkpoint G2/M transition of mitotic cell cycle DNA repair double-strand break repair regulation of transcription, DNA-templated protein phosphorylation apoptotic process cellular response to DNA damage stimulus response to oxidative stress intrinsic apoptotic signaling pathway in response to DNA damage response to gamma radiation protein catabolic process DNA damage response, signal transduction by p53 class mediator intra-S DNA damage checkpoint cellular response to stress regulation of protein catabolic process response to starvation signal transduction in response to DNA damage intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator mitotic DNA damage checkpoint positive regulation of transcription, DNA-templated protein autophosphorylation protein stabilization cell division thymocyte apoptotic process protein K63-linked ubiquitination cellular response to xenobiotic stimulus cellular response to gamma radiation mitotic spindle assembly replicative senescence regulation of signal transduction by p53 class mediator response to glycoside cellular response to bisphenol A negative regulation of DNA damage checkpoint positive regulation of anoikis regulation of autophagosome assembly positive regulation of autophagosome assembly replicative cell aging transcription, DNA-templated DNA damage induced protein phosphorylation cell cycle mitotic nuclear division phosphorylation cellular protein catabolic process signal transduction involved in intra-S DNA damage checkpoint
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Responsibility Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          México flag icon
          México

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-n9r8p:80/100.66.76.150:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline