Hamburger Menu Button
Thermo Fisher Scientific Logo
로그인
회원이 아니신가요? 계정 생성하기
  • 모든 제품 주문
    • 항체
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR 분석
    • 피펫 및 피펫 팁
    • 실험실용 원심분리기
    • 초저온 냉동고
    • 분광학
    • 비이커
    • PCR 장비 및 용품
    • 제품 카테고리 전체보기
  • 응용 분야 및 기법
    • 세포 분석
    • 실험실 장비
    • Real-Time PCR
    • PCR
    • 크로마토그래피
    • 세포 배양 및 트랜스펙션
    • DNA/RNA 추출과 분석
    • 단백질 생물학
    • 유세포분석
    • 화학 제품
    • 응용 분야 및 기법 전체보기
  • 서비스
    • 맞춤형 서비스
    • 엔터프라이즈급 실험실 정보 처리
    • 360° CDMO 및 CRO 서비스
    • CDMO 서비스
    • 임상시험 CRO 서비스
    • 장비 서비스
    • 교육 서비스
    • Unity Lab Services
    • 서비스 전체 보기
  • 지원
    • 고객센터
    • 문의하기
    • 시험성적서(COA) 및 적합성 인증서(COC)
    • Safety Data Sheets (SDS)
    • 매뉴얼
    • 인용 및 참고 문헌
    • 기기 지원
    • 기술 자료/제품 FAQ
    • 학습 센터
    • 지원 메뉴 전체보기
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • 문의하기
  • 빠른 주문
  • 주문 현황
  • 제품 문서 검색
Thermo Fisher Scientific Logo

Search

전체검색
Search button
          • 주문 현황
          • 빠른주문
          • 로그인
            로그인
            회원이 아니신가요? 계정 생성하기
            • 계정정보
            • 주문내역조회
            • 커스텀제품 및 프로젝트
            • Services Central
          • Primary Antibodies ›
          • GREM1 Antibodies

          Invitrogen

          GREM1 Polyclonal Antibody

          View all (24) GREM1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite GREM1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          GREM1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          GREM1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          GREM1 Antibody (PA5-79324) in WB

          Western blot analysis of GREM1 using GREM1 Polyclonal Antibody (Product # PA5-79324). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. Lane 1: human A549 whole cell lysates. Lane 2: rat testis tissue lysates. Lane 3: mouse testis tissue lysates. After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fat milk/... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          GREM1 Antibody in Western Blot (WB)
          GREM1 Polyclonal Antibody

          Product Details

          PA5-79324

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human Gremlin 1 (151-184aa TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746440

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human A549 whole cell, rat testis tissue, mouse testis tissue.

          Target Information

          In Xenopus, Gremlin belongs to a novel gene family that act as BMP antagonists in embryonic explants. The human homolog of Drm/Gremlin (CKTFS1B1) is localized on human chromosome 15q13--> q15. DRM-specific mRNA is expressed in different human tissues, including brain, ovary, intestine and colon. It has been suggested that down-regulation of DRM is associated with tumor progression, and support the hypothesis that human DRM may play an important role during both neuroembryological development and carcinogenesis.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: BMP antagonist; BMP antagonist; Dan family member; Cell proliferation-inducing gene 2 protein; colorectal adenoma and carcinoma 1; Cysteine knot superfamily 1, BMP antagonist 1; DAN domain family member 2; Down-regulated in Mos-transformed cells protein; down-regulated in v-mos-transformed cells; gremlin; gremlin 1 homolog, cysteine knot superfamily; gremlin 1, cysteine knot superfamily, homolog; gremlin 1-like protein; Gremlin-1; hereditary mixed polyposis syndrome; IHG-2; Increased in high glucose protein 2; increased in high glucose-2; PIG2; unnamed protein product

          View more View less

          Gene Aliases: C15DUPq; CKTSF1B1; CRAC1; CRCS4; DAND2; DRM; DUP15q; Grem; GREM1; GREMLIN; HMPS; HMPS1; IHG-2; ld; MPSH; PIG2

          View more View less

          UniProt ID: (Human) O60565, (Rat) O35793, (Mouse) O70326

          View more View less

          Entrez Gene ID: (Human) 26585, (Rat) 50566, (Mouse) 23892

          View more View less

          Function(s)
          cytokine activity protein binding morphogen activity transmembrane receptor protein tyrosine kinase activator activity BMP binding protein homodimerization activity vascular endothelial growth factor receptor 2 binding receptor agonist activity heparan sulfate proteoglycan binding
          Process(es)
          cell morphogenesis angiogenesis cell migration involved in sprouting angiogenesis positive regulation of receptor internalization mesenchymal to epithelial transition involved in metanephros morphogenesis signal transduction cell-cell signaling positive regulation of cell proliferation organ morphogenesis proximal/distal pattern formation regulation of epithelial to mesenchymal transition collagen fibril organization embryonic limb morphogenesis negative regulation of bone mineralization negative regulation of BMP signaling pathway negative regulation of chondrocyte differentiation regulation of stress-activated MAPK cascade negative regulation of osteoblast proliferation sequestering of BMP from receptor via BMP binding negative regulation of apoptotic process endothelial cell migration negative regulation of osteoblast differentiation positive regulation of angiogenesis negative regulation of transcription, DNA-templated positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter negative regulation of bone remodeling determination of dorsal identity regulation of focal adhesion assembly cardiac muscle cell differentiation limb development cardiac muscle cell myoblast differentiation negative regulation of SMAD protein import into nucleus ureteric bud formation signal transduction by p53 class mediator negative regulation of monocyte chemotaxis positive regulation of cell migration involved in sprouting angiogenesis negative regulation of canonical Wnt signaling pathway positive regulation of branching involved in ureteric bud morphogenesis negative regulation of osteoclast proliferation negative regulation of bone trabecula formation negative regulation of bone mineralization involved in bone maturation positive regulation of vascular endothelial growth factor signaling pathway positive regulation of NIK/NF-kappaB signaling branching involved in ureteric bud morphogenesis negative regulation of leukocyte chemotaxis positive regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation apoptotic process activation of transmembrane receptor protein tyrosine kinase activity negative regulation of cell growth positive regulation of NF-kappaB import into nucleus positive regulation of NF-kappaB transcription factor activity positive regulation of telomerase activity negative regulation of pathway-restricted SMAD protein phosphorylation positive regulation of protein tyrosine kinase activity negative regulation of branching involved in ureteric bud morphogenesis positive regulation of peptidyl-tyrosine autophosphorylation positive regulation of receptor activity positive regulation of cardiac muscle cell differentiation
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          온라인 주문 Plus Icon Minus Icon
          • 주문 현황
          • 주문 지원
          • 빠른 주문
          • Supply Center
          • eProcurement
          지원 Plus Icon Minus Icon
          • Help and Support
          • 고객 센터
          • 기술 지원 센터
          • 제품 문서 검색
          • 사이트 문제 보고
          교육 및 이벤트 Plus Icon Minus Icon
          • 교육 센터
          • 프로모션
          • 이벤트 및 웨비나
          • 소셜 미디어
          About Thermo Fisher Plus Icon Minus Icon
          • 소개 소개
          • 채용 채용
          • 투자자 투자자
          • 뉴스 뉴스
          • 사회적 책임 사회적 책임
          • Trademarks
          • 공정거래 공정거래
          • 정책 및 고지
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • 이용 약관
          • 개인정보 처리방침
          • 가격 및 운임 정책
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Korea flag icon
          Korea

          고객센터 문의 | 평일 09:00~18:00
          1661-9555   |   Live Chat   |   카카오톡 상담

           

          장비 서비스 문의 | 평일 09:00~18:00
          1661-5055   |   Live Chat

          고객센터 문의 | 평일 09:00~18:00
          1661-9555   |   Live Chat   |   카카오톡 상담

           

          장비 서비스 문의 | 평일 09:00~18:00
          1661-5055   |   Live Chat

          고객센터 문의 | 평일 09:00~18:00
          1661-9555   |   Live Chat   |   카카오톡 상담

           

          장비 서비스 문의 | 평일 09:00~18:00
          1661-5055   |   Live Chat

          써모 피셔 사이언티픽 코리아 주식회사
          대표자 : 석수진
          사업자 등록번호 : 117-81-46910
          입금계좌 : 하나은행 336-890014-06204
          (예금주 : 써모피셔사이언티픽코리아 주식회사)

           

          써모 피셔 사이언티픽 솔루션스 유한회사
          대표자 : 석수진
          사업자 등록번호 : 114-86-04783
          입금계좌 : 신한은행 140-004-396660
          (예금주 : 써모피셔사이언티픽솔루션스 유한회사)

           

          주소 : 서울시 강남구 광평로 281 수서오피스빌딩 12층 06349 | 통신판매업신고번호 : 2015-서울강남-00898

          ISMS Logo

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-n9r8p:80/100.66.76.150:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline