Search
Invitrogen
IFNAR1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 1
IFNAR1 Antibody (PA5-79441) in WB
Western blot analysis of IFNAR1 using IFNAR1 Polyclonal Antibody (Product # PA5-79441). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. Lane 1: human A431 whole cell lysates. Lane 2: human K562 whole cell lysates. Lane 3: human HEL whole cell lysates. After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minutes. Blocked the membrane with 5% non-fa... View More
Product Details
PA5-79441
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human
Published species
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human IFNAR1 (263-306aa HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLR).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human A431 whole cell, human K562 whole cell, human HEL whole cell.
Target Information
Interferons are widely used therapeutic agents because of their anti tumor and antiviral effects and because of their modulatory effects on the immune system (Biron,2001, Kirkwood, 2002). These cytokines produce their effects by binding to the Type 1 Interferon-& Receptor (IFNAR1). Down regulation of this receptor plays a key role in determining the magnitude and duration of cytokine signaling. This down regulation is thought to be influenced by phosphorylation of Serine 535 and 539 in the IFNAR1 (Kumar et al., 2003).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: alpha-type antiviral protein; beta-type antiviral protein; CRF2-1; Cytokine receptor class-II member 1; Cytokine receptor family 2 member 1; H3K1; IFN R1; IFN-alpha/beta receptor 1; IFN-alpha/betaR1; IFN-alpha/betaRalpha; IFN-R-1; IFNalpha/beta R1; IFNalpha/beta receptor 1; IFNalpha/beta-Ralpha; IFNalpha/betaR1; IFNR1; interferon (alpha, beta and omega) receptor 1; Interferon alpha/beta receptor 1; interferon receptor 1; interferon-alpha receptor precursor; interferon-alpha/beta receptor alpha chain; interferon-beta receptor 1; Type I interferon receptor 1; unnamed protein product
Gene Aliases: AVP; IFN-alpha-REC; IFNAR; IFNAR1; IFNBR; IFRC; IMD106
UniProt ID: (Human) P17181
Entrez Gene ID: (Human) 3454
regulation of transcription from RNA polymerase II promoter
JAK-STAT cascade
response to virus
positive regulation of metabolic process
cytokine-mediated signaling pathway
response to lipopolysaccharide
cellular response to interferon-alpha
cellular response to interferon-beta
regulation of JAK-STAT cascade
type I interferon signaling pathway
cellular response to virus
positive regulation of protein localization to nucleus
positive regulation of cellular respiration
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support