Hamburger Menu Button
Thermo Fisher Scientific Logo
Iniciar sesión
¿No tiene una cuenta? Crear una cuenta
  • Productos
    • Consumibles de laboratorio
    • Equipos de laboratorio
    • Instrumentos de Laboratorio
    • Clínica y Diagnóstico
    • Cromatografía
    • Espectrometría de Masas
    • Cultivo Celular
    • Análisis Celular
    • Anticuerpos
    • Veja todas as categorias de produtos
  • Aplicaciones
    • Cultivo celular y transfección
    • Citometría de flujo
    • Investigación sobre el cáncer
    • Cromatografía
    • Secuenciación
    • PCR
    • Soluciones para laboratorio
    • Diagnóstico de alergias
    • Ver todas las aplicaciones y técnicas
  • Servicios
    • Servicios Personalizados
    • Servicios de Capacitación
    • Informática para laboratorios de ámbito empresarial
    • Servicios financieros y de arrendamiento
    • Servicios 360° de CDMO y CRO
    • Servicios de CDMO
    • Servicios de CRO
    • Inspección de seguridad alimentaria Servicios
    • Ver todos los servicios
  • Ayuda y Soporte
    • Crear una nueva cuenta
    • Cómo hacer el pedido
    • Póngase en contacto con nosotros
    • Cambio de ubicación
    • Ver toda la ayuda y soporte técnico
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • A quiénes brindamos nuestros servicios
    • Industria biotecnológica
    • Sector biofarmacéutico
    • CDMO
    • Diagnósticos de laboratorio
    • Ciencias aplicadas e industriales
  • Ofertas especiales
  • Contáctenos
  • Orden Rápida
  • Documentos y certificados
Thermo Fisher Scientific Logo

Search

Buscar
Search button
          • Contáctenos
          • Orden Rápida
          • Iniciar sesión
            Iniciar sesión
            ¿No tiene una cuenta? Crear una cuenta
            • Cuenta
            • Pedidos
            • Productos y proyectos personalizados
          • Primary Antibodies ›
          • MEF2C Antibodies

          Invitrogen

          MEF2C Polyclonal Antibody

          View all (38) MEF2C antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite MEF2C Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (6)
          MEF2C Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          MEF2C Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 6

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          MEF2C Antibody (PA5-95568) in IHC (P)

          Immunohistochemistry analysis of MEF2C in paraffin-embedded rat cardiac muscle tissue. Antigen retrieval was performed on the tissue using citrate buffer (pH 6, 20 min) and blocked with 10% goat serum. Samples were incubated with MEF2C polyclonal antibody (Product # PA5-95568) at a 2 µg/mL dilution, followed by biotinylated goat anti-rabbit IgG (30 min, 37°C), and developed with Strepavidin-Biotin-Complex a... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          MEF2C Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MEF2C Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MEF2C Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MEF2C Antibody in Western Blot (WB)
          MEF2C Antibody in Flow Cytometry (Flow)
          MEF2C Antibody in Flow Cytometry (Flow)
          MEF2C Polyclonal Antibody

          Product Details

          PA5-95568

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.25-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence of human MEF2C (DREDHRNE FHSPIGLTRPSPDERESPSVKRMRLSEGWAT).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807370

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human K562 whole cell, human COLO320 whole cell, human DAUDI whole cell, human U937 whole cell, rat brain tissue. IHC: human tonsil tissue, rat brain tissue, mouse brain tissue. Flow: HELA cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          MEF2C is a transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. Controls cardiac morphogenesis and myogenesis, and is also involved in vascular development. Plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission. Crucial for normal neuronal development, distribution, and electrical activity in the neocortex. Necessary for proper development of megakaryocytes and platelets and for bone marrow B lymphopoiesis. Required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B cells. May also be involved in neurogenesis and in the development of cortical architecture. Isoform 3 and isoform 4, which lack the repressor domain, are more active than isoform 1 and isoform 2.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: MADS box transcription enhancer factor 2, polypeptide C; Myocyte enhancer factor 2C; Myocyte-specific enhancer factor 2C; unnamed protein product

          View more View less

          Gene Aliases: 5430401D19Rik; 9930028G15Rik; AV011172; C5DELq14.3; DEL5q14.3; Mef2; MEF2C; NEDHSIL; RGD1563119

          View more View less

          UniProt ID: (Human) Q06413, (Rat) A0A096MJY4, (Mouse) Q8CFN5

          View more View less

          Entrez Gene ID: (Human) 4208, (Rat) 499497, (Mouse) 17260

          View more View less

          Function(s)
          transcription regulatory region sequence-specific DNA binding RNA polymerase II regulatory region sequence-specific DNA binding RNA polymerase II core promoter proximal region sequence-specific DNA binding RNA polymerase II transcription factor activity, sequence-specific DNA binding transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding DNA binding AT DNA binding transcription factor activity, sequence-specific DNA binding protein binding histone deacetylase binding protein heterodimerization activity protein dimerization activity RNA polymerase II sequence-specific DNA binding transcription factor binding DNA-binding transcription factor binding sequence-specific double-stranded DNA binding RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity, RNA polymerase II core promoter sequence-specific core promoter proximal region sequence-specific DNA binding core promoter sequence-specific DNA binding transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding transcriptional activator activity, RNA polymerase II distal enhancer sequence-specific binding chromatin binding transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding activating transcription factor binding miRNA binding sequence-specific DNA binding transcription regulatory region DNA binding HMG box domain binding MADS box transcription factor
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter MAPK cascade blood vessel development osteoblast differentiation neuron migration B cell homeostasis heart looping endochondral ossification blood vessel remodeling chondrocyte differentiation germinal center formation regulation of germinal center formation response to ischemia primary heart field specification secondary heart field specification outflow tract morphogenesis sinoatrial valve morphogenesis cardiac ventricle formation regulation of transcription, DNA-templated apoptotic process humoral immune response nervous system development heart development muscle organ development skeletal muscle tissue development muscle cell fate determination learning or memory positive regulation of gene expression negative regulation of gene expression neural crest cell differentiation myotube differentiation cell differentiation neuron differentiation platelet formation negative regulation of ossification melanocyte differentiation positive regulation of bone mineralization positive regulation of B cell proliferation cellular response to trichostatin A B cell proliferation positive regulation of MAPK cascade regulation of neuron apoptotic process negative regulation of neuron apoptotic process negative regulation of blood vessel endothelial cell migration regulation of megakaryocyte differentiation positive regulation of myoblast differentiation positive regulation of neuron differentiation positive regulation of osteoblast differentiation positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter regulation of neurotransmitter secretion regulation of synaptic plasticity positive regulation of skeletal muscle tissue development neuron development cell morphogenesis involved in neuron differentiation B cell receptor signaling pathway smooth muscle cell differentiation regulation of synapse assembly regulation of synaptic transmission, glutamatergic ventricular cardiac muscle cell differentiation regulation of synaptic activity positive regulation of cardiac muscle cell proliferation excitatory postsynaptic potential regulation of dendritic spine development renal tubule morphogenesis cellular response to lipopolysaccharide cellular response to calcium ion cellular response to parathyroid hormone stimulus cellular response to xenobiotic stimulus cellular response to fluid shear stress cellular response to transforming growth factor beta stimulus glomerulus morphogenesis nephron tubule epithelial cell differentiation NMDA selective glutamate receptor signaling pathway AMPA selective glutamate receptor signaling pathway negative regulation of vascular smooth muscle cell proliferation negative regulation of vascular associated smooth muscle cell migration negative regulation of vascular endothelial cell proliferation positive regulation of macrophage apoptotic process positive regulation of cardiac muscle cell differentiation positive regulation of behavioral fear response epithelial cell proliferation involved in renal tubule morphogenesis positive regulation of skeletal muscle cell differentiation transcription from RNA polymerase II promoter response to virus positive regulation of cardiac muscle hypertrophy positive regulation of alkaline phosphatase activity cardiac muscle hypertrophy in response to stress dentate gyrus development monocyte differentiation response to nutrient levels response to vitamin E cellular response to drug skeletal muscle cell differentiation positive regulation of MAP kinase activity cell fate commitment embryonic viscerocranium morphogenesis embryonic skeletal system morphogenesis negative regulation of epithelial cell proliferation cardiac muscle cell differentiation palate development transdifferentiation regulation of sarcomere organization cartilage morphogenesis cellular response to retinoic acid cellular response to glucose stimulus cellular response to growth factor stimulus cellular response to organic cyclic compound positive regulation of cell proliferation in bone marrow positive regulation of protein homodimerization activity regulation of N-methyl-D-aspartate selective glutamate receptor activity regulation of alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity transcription, DNA-templated multicellular organism development
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Pedidos Plus Icon Minus Icon
          • Estatus del pedido
          • Ayuda para pedidos
          • Orden Rápida
          • Supply Center
          • eProcurement
          Soporte Plus Icon Minus Icon
          • Ayuda y soporte
          • Entre en Contacto
          • Centros de asistencia técnica
          • Consultar documentos y certificados
          • Informar de un problema en la web
          Recursos Plus Icon Minus Icon
          • Centros de aprendizaje
          • Promociones
          • Eventos & Webinars
          • Medios Sociales
          Acerca de Thermo Fisher Plus Icon Minus Icon
          • Acerca de nosotros Acerca de nosotros
          • Empleo Empleo
          • Inversores Inversores
          • Noticias Noticias
          • Responsabilidad social Responsabilidad social
          • Marcas comerciales
          • Políticas y avisos
          Nuestro Portafolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Argentina flag icon
          Argentina

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-lnstr:80/100.66.74.145:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline