Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • PAR1 Antibodies

          Invitrogen

          PAR1 Polyclonal Antibody

          2 Published Figures
          1 Reference
          View all (18) PAR1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite PAR1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (2)
          • Published Figures (2)
          PAR1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          PAR1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 4

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          PAR1 Antibody (PA5-94929) in IHC (P)

          Immunohistochemistry analysis of PAR1 in paraffin-embedded human placenta tissue. Samples were incubated with PAR1 polyclonal antibody (Product # PA5-94929). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          PAR1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          PAR1 Antibody in Western Blot (WB)
          PAR1 Antibody in Western Blot (WB)
          PAR1 Antibody in Western Blot (WB)
          PAR1 Polyclonal Antibody

          Product Details

          PA5-94929

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          View 1 publication 1 publication

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human

          Published species

          Human

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human Thrombin Receptor (46-82aa RNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQK).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2806735

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: MCF-7 whole cell, HELA whole cell, 22RV1 whole cell, SW620 whole cell. IHC: Human Placenta Tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Thrombin is a serine protease that is involved in platelet aggregation and blood coagulation. It is cleaved from its precursor, prothrombin, and converts fibrinogen to fibrin in the final step of the clotting cascade. Thrombin mediates its regulatory effects by activating cell surface G-protein coupled receptors which include PAR-1, PAR-2 and PAR3.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: C HTR; Coagulation factor II receptor; PAR-1; PIG18A; protease-activated receptor 1; Proteinase-activated receptor 1; Thrombin receptor; unnamed protein product

          View more View less

          Gene Aliases: CF2R; F2R; HTR; PAR-1; PAR1; TR

          View more View less

          UniProt ID: (Human) P25116

          View more View less

          Entrez Gene ID: (Human) 2149

          View more View less

          Function(s)
          G-protein alpha-subunit binding G-protein coupled receptor activity receptor binding protein binding thrombin receptor activity G-protein beta-subunit binding
          Process(es)
          connective tissue replacement involved in inflammatory response wound healing negative regulation of glomerular filtration inflammatory response signal transduction G-protein coupled receptor signaling pathway phospholipase C-activating G-protein coupled receptor signaling pathway positive regulation of cytosolic calcium ion concentration establishment of synaptic specificity at neuromuscular junction blood coagulation hemostasis positive regulation of cell proliferation negative regulation of cell proliferation response to wounding anatomical structure morphogenesis glutamate secretion platelet activation regulation of blood coagulation positive regulation of blood coagulation positive regulation of cell migration response to lipopolysaccharide regulation of interleukin-1 beta production positive regulation of interleukin-6 production positive regulation of interleukin-8 production positive regulation of collagen biosynthetic process positive regulation of Rho protein signal transduction dendritic cell homeostasis positive regulation of apoptotic process positive regulation of I-kappaB kinase/NF-kappaB signaling positive regulation of MAPK cascade negative regulation of neuron apoptotic process cell-cell junction maintenance positive regulation of transcription, DNA-templated positive regulation of vasoconstriction positive regulation of smooth muscle contraction positive regulation of JAK-STAT cascade regulation of synaptic plasticity homeostasis of number of cells within a tissue release of sequestered calcium ion into cytosol positive regulation of release of sequestered calcium ion into cytosol positive regulation of protein kinase B signaling positive regulation of calcium ion transport platelet dense granule organization regulation of biological quality positive regulation of ERK1 and ERK2 cascade thrombin receptor signaling pathway trans-synaptic signaling by endocannabinoid, modulating synaptic transmission negative regulation of renin secretion into blood stream
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-n9r8p:80/100.66.76.150:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline