Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
PC4 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 5
PC4 Antibody (PA5-80084) in IHC (P)
Immunohistochemistry (Paraffin) analysis of PC4 in paraffin-embedded section of human intestinal cancer tissue using PC4 Polyclonal Antibody (Product # PA5-80084). Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody at a 5 µg/mL dilution overnight... View More
Product Details
PA5-80084
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PC4 (96-127aa MKPGRKGISLNPEQWSQLKEQISDIDDAVRKL).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human Hela whole cell, human A549 whole cell, human MCF-7 whole cell, human T47D whole cell, human PC-3 whole cell, human Jurkat whole cell, human placenta tissue, human HL-60 whole cell, rat liver tissue, rat spleen tissue, rat stomach tissue, rat RH35 whole cell, mouse liver tissue, mosue spleen tissue. IHC: human esophageal squamous carcinoma tissue, human endometrioid adenocarcinoma type I tissue.
Target Information
PC4 (activated RNA polymerase II transcription cofactor 4) is a transcriptional coactivator, possessing the ability to suppress promoter-driven as well as nonspecific transcription via its DNA binding activity. The repressive activity of PC4 on promoter-driven transcription is alleviated by transcription factor TFIIH. TFIIH protects promoters from PC4-mediated repression by relieving the topological constraint imposed by PC4 through the ERCC3 helicase activity.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: activated RNA polymerase II transcription cofactor 4; Activated RNA polymerase II transcriptional coactivator p15; p14; PC4; Positive cofactor 4; pR-ET2 encoded oncodevelopmental protein; RNA polymerase II transcriptional coactivator; Single-stranded DNA-binding protein p9; SUB1 homolog; TIS7
Gene Aliases: AI842364; p14; P15; P9; PC4; RPO2TC1; SUB1
UniProt ID: (Human) P53999, (Rat) Q63396, (Mouse) P11031
Entrez Gene ID: (Human) 10923, (Rat) 192269, (Mouse) 20024
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support