Synthetic peptide sequence: DLTVYAIDPQTNRAIDRNELFKFLDGKLLDINKDFQ.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
PCDH15 is a member of the cadherin superfamily. Family members encode integral membrane proteins that mediate calcium-dependent cell-cell adhesion. PCDH15 consists of a signal peptide, 11 extracellular calcium-binding domains, a transmembrane domain and a unique cytoplasmic domain. It plays an essential role in maintenance of normal retinal and cochlear function. Mutations in this gene have been associated with hearing loss, which is consistent with its location at the Usher syndrome type 1F (USH1F) critical region on chromosome 10.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: Ames waltzer; cadherin-related family member 15; DKFZp667A1711; protocadherin 15 CD2; protocadherin 15 CD3 isoform; Protocadherin-15; protocadherin-related 15; RP11-449J3.2
Gene Aliases: av; BB078305; CDHR15; DFNB23; ENSMUSG00000046980; Gm9815; nmf19; PCDH15; USH1F
UniProt ID: (Human) Q96QU1, (Mouse) Q0ZM35
Entrez Gene ID: (Human) 65217, (Rat) 690865, (Mouse) 11994
Molecular Function:
cadherin
cell adhesion molecule
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support