Invitrogen

PDE5 Polyclonal Antibody

Product Image Gallery

PDE5 Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of PDE5 on paraffin-embedded human thyroid cancer tissue. Sample was incubated with PDE5 polyclonal antibody (Product# PA5-79796) with a dilution of 1 µg/mL, and developed by Streptavidin-Biotin-Complex (SABC) method.

PDE5 Antibody in Western Blot (WB) — Western blot analysis of PDE5 in rat lung extract (lane 1) and PANC-1 whole cell lysate(lane 2). Sample was incubated with PDE5 polyclonal antibody (Product # PA5-79796) at a dilution of 0.5 µg/mL. Signal development was performed using a chemiluminescence (ECL) kit.

Product Details

PA5-79796

Applications	Tested Dilution	Publications
Western Blot (WB)	0.1-0.5 µg/mL	-
Immunohistochemistry (Paraffin) (IHC (P))	0.5-1 µg/mL	-
Immunohistochemistry (Frozen) (IHC (F))	-	View 1 publication 1 publication

Product Specifications
Species Reactivity	Human, Rat
Published species	Mouse
Host/Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human PDE5A.
Conjugate	Unconjugated
Form	Lyophilized
Concentration	500 µg/mL
Purification	Antigen affinity chromatography
Storage buffer	PBS with 4mg trehalose
Contains	0.05mg sodium azide
Storage conditions	-20°C
RRID	AB_2746911

Product Specific Information

The synthetic peptide sequence is 20-63aa, QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH

Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.

Target Information

The cyclic monophosphate nucleotides (cyclic adenosine monophosphate [cAMP] and cyclic guanosine monophosphate [cGMP] are found ubiquitously in mammalian cells and act as second messenger transducers to effect the intracellular actions of a variety of G protein coupled receptors (GPCRs) for hormones, cytokines, and neurotransmitters. Cyclic nucleotides are important intracellular second messenger which play important role in a variety of signal transduction process.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Product References

Repurposing erectile dysfunction drugs tadalafil and vardenafil to increase bone mass.

Proceedings of the National Academy of Sciences of the United States of America

Kim SM,Taneja C,Perez-Pena H,Ryu V,Gumerova A,Li W,Ahmad N,Zhu LL,Liu P,Mathew M,Korkmaz F,Gera S,Sant D,Hadelia E,Ievleva K,Kuo TC,Miyashita H,Liu L,Tourkova I,Stanley S,Lizneva D,Iqbal J,Sun L,Tamler R,Blair HC,New MI,Haider S,Yuen T,Zaidi M

PA5-79796 was used in Immunohistochemistry (Frozen) to report that two widely-used drugs for erectile dysfunction, tadalafil and vardenafil, trigger bone gain in mice through a combination of anabolic and antiresorptive actions on the skeleton.

Tue Jun 23 00:00:00 EDT 2020

Bioinformatics

Protein Aliases: CGB-PDE; cGMP-binding cGMP specific phosphodiesterase 5A2; cGMP-binding cGMP-specific 3',5'-cyclic nucleotide phosphodiesterase; cGMP-binding cGMP-specific phosphodiesterase; cGMP-specific 3',5'-cyclic phosphodiesterase; cGMP-specific phosphodiesterase PDE5A2; cGMP-specific phosphodiesterase type 5A; phosphodiesterase 5A, cGMP-specific; phosphodiesterase isozyme 5; phosphodiesterase type 5

Gene Aliases: CGB-PDE; CN5A; PDE5; PDE5A; PDE5A2

UniProt ID: (Human) O76074, (Rat) O54735

Entrez Gene ID: (Human) 8654, (Rat) 171115

Molecular Function: phosphodiesterase