Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Immunohistochemistry (Frozen) (IHC (F)) |
- | View 1 publication 1 publication |
Product Specifications | |
---|---|
Species Reactivity |
Human, Rat |
Published species |
Mouse |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of human PDE5A. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2746911 |
The synthetic peptide sequence is 20-63aa, QKQQQRDQDSVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
The cyclic monophosphate nucleotides (cyclic adenosine monophosphate [cAMP] and cyclic guanosine monophosphate [cGMP] are found ubiquitously in mammalian cells and act as second messenger transducers to effect the intracellular actions of a variety of G protein coupled receptors (GPCRs) for hormones, cytokines, and neurotransmitters. Cyclic nucleotides are important intracellular second messenger which play important role in a variety of signal transduction process.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: CGB-PDE; cGMP-binding cGMP specific phosphodiesterase 5A2; cGMP-binding cGMP-specific 3',5'-cyclic nucleotide phosphodiesterase; cGMP-binding cGMP-specific phosphodiesterase; cGMP-specific 3',5'-cyclic phosphodiesterase; cGMP-specific phosphodiesterase PDE5A2; cGMP-specific phosphodiesterase type 5A; phosphodiesterase 5A, cGMP-specific; phosphodiesterase isozyme 5; phosphodiesterase type 5
Gene Aliases: CGB-PDE; CN5A; PDE5; PDE5A; PDE5A2
UniProt ID: (Human) O76074, (Rat) O54735
Entrez Gene ID: (Human) 8654, (Rat) 171115
Molecular Function:
phosphodiesterase
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support