Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • PDGF-B Antibodies

          Invitrogen

          PDGF-B Polyclonal Antibody

          View all (19) PDGF-B antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite PDGF-B Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          PDGF-B Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          PDGF-B Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          PDGF-B Antibody (PA5-95438) in WB

          Western blot analysis of PDGF beta in, Lane 1: rat brain tissue lysates, Lane 2: mouse brain tissue lysates. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50 µg of sample under reducing conditions. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. The membrane was blocked with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was incubated with PDGF-B Polyclonal Antibod... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          PDGF-B Antibody in Western Blot (WB)
          PDGF-B Polyclonal Antibody

          Product Details

          PA5-95438

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human PDGF beta (89-129aa AEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQR).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807241

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat brain tissue, mouse brain tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          This gene encodes a member of the protein family comprised of both platelet-derived growth factors (PDGF) and vascular endothelial growth factors (VEGF). The encoded preproprotein is proteolytically processed to generate platelet-derived growth factor subunit B, which can homodimerize, or alternatively, heterodimerize with the related platelet-derived growth factor subunit A. These proteins bind and activate PDGF receptor tyrosine kinases, which play a role in a wide range of developmental processes. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 17, at sites where this gene and that for collagen type 1, alpha 1 are located, are associated with dermatofibrosarcoma protuberans, a rare skin tumor. Alternative splicing results in multiple transcript variants.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: becaplermin; c-sis; epididymis secretory sperm binding protein; orf 2; pdgf protein; PDGF subunit B; PDGF, B chain; PDGF-2; PDGFB; platelet derived growth factor, B polypeptide; platelet-derived growth factor 2; Platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); Platelet-derived growth factor subunit B; platelet-derived growth factor, beta polypeptide (oncogene SIS); Platelet-derived growth factor, same as Sis (Simian sarcoma viral oncogene homologue, c-sis); Proto-oncogene c-Sis; unnamed protein product

          View more View less

          Gene Aliases: c-sis; IBGC5; PDGF-2; PDGF-B; PDGF2; PDGFB; SIS; SSV

          View more View less

          UniProt ID: (Human) P01127, (Mouse) P31240, (Rat) Q05028

          View more View less

          Entrez Gene ID: (Human) 5155, (Mouse) 18591, (Rat) 24628

          View more View less

          Function(s)
          platelet-derived growth factor receptor binding protein binding collagen binding growth factor activity superoxide-generating NADPH oxidase activator activity chemoattractant activity identical protein binding protein homodimerization activity protein heterodimerization activity receptor agonist activity platelet-derived growth factor binding receptor binding growth factor
          Process(es)
          angiogenesis embryonic placenta development positive regulation of endothelial cell proliferation monocyte chemotaxis positive regulation of glomerular filtration protein phosphorylation transmembrane receptor protein tyrosine kinase signaling pathway heart development positive regulation of cell proliferation response to wounding gene expression regulation of gene expression negative regulation of phosphatidylinositol biosynthetic process negative regulation of platelet activation positive regulation of macromolecule biosynthetic process positive regulation of gene expression negative regulation of gene expression positive regulation of cell-substrate adhesion smooth muscle adaptation positive regulation of smooth muscle cell migration peptidyl-tyrosine phosphorylation hemopoiesis positive regulation of cell migration positive regulation of protein autophosphorylation intracellular signal transduction interleukin-18-mediated signaling pathway positive regulation of metanephric mesenchymal cell migration by platelet-derived growth factor receptor-beta signaling pathway cellular response to platelet-derived growth factor stimulus paracrine signaling positive regulation of MAP kinase activity positive regulation of MAPK cascade positive regulation of blood vessel endothelial cell migration positive regulation of mitotic nuclear division negative regulation of transcription, DNA-templated positive regulation of transcription, DNA-templated platelet-derived growth factor receptor signaling pathway positive regulation of fibroblast proliferation positive regulation of smooth muscle cell proliferation positive chemotaxis positive regulation of chemotaxis regulation of multicellular organismal process positive regulation of cell division positive regulation of protein kinase B signaling cell chemotaxis positive regulation of ERK1 and ERK2 cascade cellular response to growth factor stimulus cellular response to mycophenolic acid positive regulation of glomerular mesangial cell proliferation metanephric glomerular mesangial cell development reactive oxygen species metabolic process positive regulation of calcium ion import positive regulation of hyaluronan biosynthetic process positive regulation of intracellular signal transduction negative regulation of pri-miRNA transcription from RNA polymerase II promoter positive regulation of pri-miRNA transcription from RNA polymerase II promoter positive regulation of vascular smooth muscle cell proliferation positive regulation of vascular associated smooth muscle cell migration negative regulation of vascular smooth muscle cell differentiation positive regulation of vascular smooth muscle cell dedifferentiation positive regulation of reactive oxygen species metabolic process positive regulation of DNA biosynthetic process positive regulation of metanephric mesenchymal cell migration substrate-dependent cell migration multicellular organism development synapse assembly positive regulation of phosphatidylinositol 3-kinase signaling neuron remodeling peptidyl-serine phosphorylation glial cell development cell projection assembly actin cytoskeleton organization negative regulation of cell migration negative regulation of protein binding activation of protein kinase activity activation of protein kinase B activity positive regulation of endothelial cell chemotaxis by VEGF-activated vascular endothelial growth factor receptor signaling pathway eye photoreceptor cell development positive regulation of phosphatidylinositol 3-kinase activity positive regulation of cyclin-dependent protein serine/threonine kinase activity positive regulation of DNA replication positive regulation of fibroblast growth factor receptor signaling pathway positive regulation of vasoconstriction negative regulation of vasodilation positive regulation of mitotic cell cycle, embryonic blood vessel morphogenesis regulation of peptidyl-tyrosine phosphorylation positive regulation of peptidyl-tyrosine phosphorylation retina development in camera-type eye branching involved in salivary gland morphogenesis epithelial cell proliferation involved in salivary gland morphogenesis cardiac vascular smooth muscle cell differentiation positive regulation of protein tyrosine kinase activity retina vasculature development in camera-type eye metanephric glomerular mesangial cell proliferation involved in metanephros development response to hypoxia DNA replication blood coagulation response to organic substance response to organic cyclic compound cell growth response to estradiol response to insulin wound healing regulation of cell proliferation response to drug response to estrogen metanephric glomerular endothelium development
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-blue-744bc48644-fvx7n:80/100.66.78.247:80.
          git-commit: 747bde55a712f6f97bf7760408d445eefba4e16f
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.0-Offline