Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Cell Analysis
    • Antibodies
    • Mass Spectrometry
    • Cell Culture
    • Laboratory Instruments
    • Clinical and Diagnostics
    • Chromatography
    • Laboratory Equipment
    • Laboratory Supplies
    • Molecular Biology and Nucleic Acid Analysis
    • Sequence-Specific Nucleic Acid Products
    • See all product categories
  • Applications
    • Cell Culture and Transfection
    • Flow Cytometry
    • Cancer Research
    • Chromatography
    • Sequencing
    • PCR
    • Lab Solutions
    • Allergy Diagnostics
    • See all applications and techniques
  • Services
    • Cell Biology Services
    • Custom Services
    • Training Services
    • Lab Informatics Services
    • Financial and Leasing Services
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Food Safety Inspection Services
    • See all services
  • Help and Support
    • How to Order
    • Promotions and Online Offers
    • Contact Us
    • Change Location
    • Create a New Account
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
          • Primary Antibodies ›
          • PDPK1 Antibodies

          Invitrogen

          PDPK1 Polyclonal Antibody

          View all (42) PDPK1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite PDPK1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (6)
          PDPK1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          PDPK1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 6

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          PDPK1 Antibody (PA5-79801) in IHC (P)

          Immunohistochemistry analysis of PDPK1 on paraffin-embedded human lung cancer tissue. Antigen retrieval was performed using citrate buffer (pH6, epitope retrieval solution) for 20 mins. Sample was blocked using 10% goat serum, incubated with PDPK1 polyclonal antibody (Product# PA5-79801) with a dilution of 1 µg/mL (overnight at 4°C), and followed by biotinylated goat anti-rabbit IgG (30 minutes at 37°C). De... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          PDPK1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          PDPK1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          PDPK1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          PDPK1 Antibody in Immunohistochemistry (Frozen) (IHC (F))
          PDPK1 Antibody in Immunohistochemistry (Frozen) (IHC (F))
          PDPK1 Antibody in Western Blot (WB)
          PDPK1 Polyclonal Antibody

          Product Details

          PA5-79801

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunohistochemistry (Frozen) (IHC (F))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human PDPK1 (524-556aa YLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746916

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Liver Tissue, Rat Lung Tissue, Mouse Liver Tissue, Mouse Lung Tissue, COLO320 whole cell, MCF-7 whole cell. IHC: Mouse Intestine tissue, Rat Testis tissue, Human Lung Cancer tissue IHC-F: human placenta tissue, mouse small intestine tissue.

          Target Information

          PDPK1 (3 Phosphoinositide Dependent Protein Kinase 1) phosphorylates AGC kinases. PDPK1 activates conventional PKC and PKC zeta through phosphorylation of critical threonine residues in the activation loop. PDPK1 also phosphorylates Protein Kinase B (PKB) at threonine 308 in the presence of phosphatidylinositol-3,4,5-trisphosphate. Active Akt inactivates Glycogen Synthase Kinase 3 (GSK3), eventually leading to the dephosphorylation and activation of glycogen synthase, and the stimulation of glycogen synthesis. Because of the role that PDPK1 plays in insulin-induced glycogen synthesis and PKC activation, it is a potentially important target for metabolic drug research.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: 3-phosphoinositide dependent protein kinase-1; 3-phosphoinositide-dependent protein kinase 1; 3-phosphoinositide-dependent protein kinase 2 pseudogene; HGNC:8809; hPDK1; isoenzyme 1; kinase isoenzyme 1; lipoamide; mPDK1; OTTHUMP00000174525; OTTHUMP00000205076; PDPK1; PkB kinase; PkB kinase like gene 1; PkB-like 1; predicted protein of HQ0461; Protein kinase B kinase; Putative 3-phosphoinositide-dependent protein kinase 2; unnamed protein product

          View more View less

          Gene Aliases: PDK1; PDPK1; PDPK2; PDPK2P; PRO0461

          View more View less

          UniProt ID: (Human) O15530, (Mouse) Q9Z2A0, (Rat) O55173

          View more View less

          Entrez Gene ID: (Human) 5170, (Mouse) 18607, (Rat) 81745

          View more View less

          Function(s)
          nucleotide binding protein kinase activity protein serine/threonine kinase activity 3-phosphoinositide-dependent protein kinase activity protein binding ATP binding phospholipase activator activity kinase activity transferase activity phospholipase binding protein serine kinase activity insulin receptor binding transferase activity, transferring phosphorus-containing groups protein kinase binding non-receptor serine/threonine protein kinase
          Process(es)
          type B pancreatic cell development protein phosphorylation hyperosmotic response epidermal growth factor receptor signaling pathway insulin receptor signaling pathway regulation of endothelial cell migration negative regulation of cardiac muscle cell apoptotic process cell migration calcium-mediated signaling actin cytoskeleton organization negative regulation of transforming growth factor beta receptor signaling pathway T cell costimulation cellular response to insulin stimulus negative regulation of toll-like receptor signaling pathway intracellular signal transduction negative regulation of apoptotic process regulation of I-kappaB kinase/NF-kappaB signaling regulation of mast cell degranulation protein kinase B signaling positive regulation of blood vessel endothelial cell migration positive regulation of angiogenesis protein autophosphorylation insulin-like growth factor receptor signaling pathway positive regulation of release of sequestered calcium ion into cytosol positive regulation of protein kinase B signaling cellular response to epidermal growth factor stimulus extrinsic apoptotic signaling pathway vascular endothelial cell response to laminar fluid shear stress intracellular signaling cassette positive regulation of protein localization to plasma membrane positive regulation of sprouting angiogenesis positive regulation of vascular endothelial cell proliferation negative regulation of endothelial cell apoptotic process transcription, DNA-templated regulation of transcription, DNA-templated negative regulation of protein kinase activity signal transduction positive regulation of phospholipase activity phosphorylation peptidyl-threonine phosphorylation activation of protein kinase B activity focal adhesion assembly positive regulation of establishment of protein localization to plasma membrane
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          • Social Media
          • Contact Us
          • Report a Site Issue
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Argentina flag icon
          Argentina

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-5cvsx:80/100.66.79.163:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline