Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • PIK3CB Antibodies

          Invitrogen

          PIK3CB Polyclonal Antibody

          View all (17) PIK3CB antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Protocols
          Questions & Answers
          Tech Support

          Cite PIK3CB Polyclonal Antibody

          • Antibody Testing Data (3)
          PIK3CB Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          PIK3CB Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 3

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          PIK3CB Antibody (PA5-79821) in IHC (P)

          Immunohistochemistry analysis of PIK3CB on paraffin-embedded human intestinal cancer tissue. Antigen retrieval was performed using citrate buffer (pH6, epitope retrieval solution) for 20 mins. Sample was blocked using 10% goat serum, incubated with PIK3CB polyclonal antibody (Product# PA5-79821) with a dilution of 1 µg/mL (overnight at 4°C), and followed by biotinylated goat anti-rabbit IgG (30 minutes at 3... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          PIK3CB Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          PIK3CB Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          PIK3CB Antibody in Western Blot (WB)
          PIK3CB Polyclonal Antibody

          Product Details

          PA5-79821

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence in the middle region of human PIK3CB (556-598aa DLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIW).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746936

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat liver tissue, rat kidney tissue, mouse spleen tissue, mouse thymus tissue, MCF-7 whole cell, K562 whole cell. IHC: human intestinal cancer tissue, human lung cancer tissue.

          Target Information

          PIK3CB (phosphatyidylinositol 4,5-biphosphate 3-kinase catalyic subunit beta isoform) is a phosphoinositide-3-kinase that phosphorylates PtdIns (phosphatidylinositol), PtdIns4P (phosphatidylinositol 4-phosphate), and PtdIns(4,5)P2 (phosphatidylinositol 4,5-biphosphate) to generate phosphatidylinositol 3,4,5-triphosphate (PIP3). PIP3 plays a key role in recruiting PH domain-containing proteins to the membrane and activating signaling cascades involved in cell growth, survival, proliferation, motility, and morphology.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: catalytic phosphatidylinositol 3-kinase beta; p110beta; phosphatidylinositol 3-kinase catalytic subunit beta isoform; phosphatidylinositol 3-kinase, catalytic subunit, beta isoform; phosphatidylinositol 3-kinase, catalytic, beta polypeptide; Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta; Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform; phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform; phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta; phosphoinositide-3-kinase, catalytic, beta polypeptide; PI3-kinase p110 subunit beta; PI3-kinase subunit beta; PI3K; PI3K-beta; PI3Kbeta; pi3kcb; PtdIns-3-kinase p110; ptdIns-3-kinase subunit beta; PtdIns-3-kinase subunit p110-beta; Serine/threonine protein kinase PIK3CB

          View more View less

          Gene Aliases: 1110001J02Rik; AI447572; P110BETA; PI3K; PI3KBETA; PIK3C1; PIK3CB

          View more View less

          UniProt ID: (Human) P42338, (Mouse) Q8BTI9, (Rat) Q9Z1L0

          View more View less

          Entrez Gene ID: (Human) 5291, (Mouse) 74769, (Rat) 85243

          View more View less

          Function(s)
          protein binding ATP binding 1-phosphatidylinositol-3-kinase activity phosphatidylinositol 3-kinase activity 1-phosphatidylinositol-4-phosphate 3-kinase activity insulin receptor substrate binding phosphatidylinositol-4,5-bisphosphate 3-kinase activity nucleotide binding kinase activity transferase activity transferase activity, transferring phosphorus-containing groups phosphotransferase activity, alcohol group as acceptor kinase
          Process(es)
          activation of MAPK activity endothelial cell proliferation regulation of cell-matrix adhesion phosphatidylinositol biosynthetic process cellular calcium ion homeostasis autophagy chemotaxis homophilic cell adhesion via plasma membrane adhesion molecules signal transduction transmembrane receptor protein tyrosine kinase signaling pathway G-protein coupled receptor signaling pathway positive regulation of autophagy positive regulation of gene expression phosphatidylinositol 3-kinase signaling regulation of phosphatidylinositol 3-kinase signaling cell migration platelet activation phosphatidylinositol-3-phosphate biosynthetic process Fc-epsilon receptor signaling pathway Fc-gamma receptor signaling pathway involved in phagocytosis embryonic cleavage phosphatidylinositol phosphorylation vascular endothelial growth factor receptor signaling pathway phosphatidylinositol-mediated signaling T cell receptor signaling pathway leukocyte migration angiogenesis involved in wound healing platelet aggregation regulation of clathrin-mediated endocytosis adaptive immune response protein phosphorylation endocytosis inflammatory response cell adhesion response to wounding phosphorylation innate immune response cell chemotaxis
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-55658555d6-7l2qm:80/100.66.75.127:80.
          git-commit: ec8e7df5f8fec8d765bd419205f1b5046a016d37
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.41.0-Offline