Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
            • Instrument Management
          • Primary Antibodies ›
          • PIK3CB Antibodies

          Invitrogen

          PIK3CB Polyclonal Antibody

          View all (17) PIK3CB antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite PIK3CB Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (3)
          PIK3CB Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          PIK3CB Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 3

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          PIK3CB Antibody (PA5-79821) in IHC (P)

          Immunohistochemistry analysis of PIK3CB on paraffin-embedded human intestinal cancer tissue. Antigen retrieval was performed using citrate buffer (pH6, epitope retrieval solution) for 20 mins. Sample was blocked using 10% goat serum, incubated with PIK3CB polyclonal antibody (Product# PA5-79821) with a dilution of 1 µg/mL (overnight at 4°C), and followed by biotinylated goat anti-rabbit IgG (30 minutes at 3... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          PIK3CB Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          PIK3CB Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          PIK3CB Antibody in Western Blot (WB)
          PIK3CB Polyclonal Antibody

          Product Details

          PA5-79821

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence in the middle region of human PIK3CB (556-598aa DLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIW).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746936

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat liver tissue, rat kidney tissue, mouse spleen tissue, mouse thymus tissue, MCF-7 whole cell, K562 whole cell. IHC: human intestinal cancer tissue, human lung cancer tissue.

          Target Information

          PIK3CB (phosphatyidylinositol 4,5-biphosphate 3-kinase catalyic subunit beta isoform) is a phosphoinositide-3-kinase that phosphorylates PtdIns (phosphatidylinositol), PtdIns4P (phosphatidylinositol 4-phosphate), and PtdIns(4,5)P2 (phosphatidylinositol 4,5-biphosphate) to generate phosphatidylinositol 3,4,5-triphosphate (PIP3). PIP3 plays a key role in recruiting PH domain-containing proteins to the membrane and activating signaling cascades involved in cell growth, survival, proliferation, motility, and morphology.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: 110 kda catalytic subunit; catalytic phosphatidylinositol 3-kinase beta; p110beta; phosphatidylinositol 3-kinase catalytic subunit beta isoform; phosphatidylinositol 3-kinase, catalytic subunit, beta isoform; phosphatidylinositol 3-kinase, catalytic, beta polypeptide; Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta; Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform; phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit beta; phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta isoform; phosphoinositide-3-kinase, catalytic, beta polypeptide; PI3-kinase p110 subunit beta; PI3-kinase subunit beta; PI3K; PI3K-beta; PI3Kbeta; pi3kcb; PtdIns-3-kinase p110; ptdIns-3-kinase subunit beta; PtdIns-3-kinase subunit p110-beta; Serine/threonine protein kinase PIK3CB; unnamed protein product

          View more View less

          Gene Aliases: 1110001J02Rik; AI447572; P110BETA; PI3K; PI3KBETA; PIK3C1; PIK3CB

          View more View less

          UniProt ID: (Human) P42338, (Mouse) Q3U4Q1, (Rat) Q9Z1L0

          View more View less

          Entrez Gene ID: (Human) 5291, (Mouse) 74769, (Rat) 85243

          View more View less

          Function(s)
          nucleotide binding protein binding ATP binding kinase activity 1-phosphatidylinositol-3-kinase activity transferase activity 1-phosphatidylinositol-4-phosphate 3-kinase activity insulin receptor substrate binding phosphatidylinositol-4,5-bisphosphate 3-kinase activity phosphatidylinositol kinase activity protein serine kinase activity transferase activity, transferring phosphorus-containing groups phosphotransferase activity, alcohol group as acceptor phosphatidylinositol 3-kinase activity kinase
          Process(es)
          endothelial cell proliferation regulation of cell-matrix adhesion leukocyte mediated immunity response to ischemia sphingosine-1-phosphate signaling pathway lipid metabolic process cellular calcium ion homeostasis endocytosis autophagy chemotaxis cell adhesion homophilic cell adhesion via plasma membrane adhesion molecules signal transduction transmembrane receptor protein tyrosine kinase signaling pathway G-protein coupled receptor signaling pathway positive regulation of autophagy positive regulation of endothelial cell migration positive regulation of gene expression cell migration platelet activation positive regulation of neutrophil apoptotic process positive regulation of Rac protein signal transduction phosphatidylinositol-3-phosphate biosynthetic process embryonic cleavage natural killer cell mediated cytotoxicity negative regulation of MAPK cascade protein kinase B signaling innate immune response positive regulation of nitric oxide biosynthetic process phosphatidylinositol phosphorylation phosphatidylinositol-mediated signaling negative regulation of protein kinase B signaling angiogenesis involved in wound healing platelet aggregation negative regulation of vascular endothelial growth factor signaling pathway negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway negative regulation of sprouting angiogenesis regulation of clathrin-mediated endocytosis adaptive immune response protein phosphorylation inflammatory response response to wounding phosphatidylinositol 3-kinase signaling phosphorylation cell chemotaxis
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-6b469b8bb7-msbq7:80/100.66.78.64:80.
          git-commit: a334af76dff23450325448aedefe62379591458a
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.1-2026.04.16-1.0