Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture and Transfection
    • Chemicals
    • Chromatography
    • Electron Microscopes
    • Lab Plasticware and Supplies
    • Lab Centrifuges
    • Lab Solutions
    • Mass Spectrometers
    • Next Generation Sequencers
    • See all product categories
  • Applications
    • Brands
    • Industrial and Applied Sciences
    • Food and Beverage
    • Forensics
    • Lab Solutions
    • Life Sciences
    • Pharma and Biopharma
    • Biotechnology
    • Clinical and Diagnostics
    • Digital Solutions
    • See all applications
  • Services
    • Lab Instrument and Equipment Services
    • Custom Services
    • Training Services
    • Financial and Leasing Services
    • Enterprise Level Lab Informatics
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Cell Biology Services
    • Food Safety Inspection Services
    • See all services
  • Help and Support
    • Contact Us
    • Product Documentation
    • Knowledge Base and Product FAQs
    • Learning Centers
    • Supply Center
    • eProcurement Solutions
    • Lab Instrument and Equipment Support
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • New Products
  • Special Offers
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
            • Instrument Management
          • Primary Antibodies ›
          • PML Antibodies

          Invitrogen

          PML Polyclonal Antibody

          View all (23) PML antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite PML Polyclonal Antibody

          {{$ctrl.translations['antibody.pdp.skuNotes.additionalInformation']}}:

          {{$ctrl.translations[$ctrl.isSkuNotesCollapsed ? 'antibody.pdp.skuNotes.viewMore' : 'antibody.pdp.skuNotes.viewLess']}}
          • Antibody Testing Data (4)
          PML Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          PML Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 4

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          PML Antibody (PA5-79836) in IHC (P)

          Immunohistochemistry analysis of PML on paraffin-embedded mouse spleen tissue. Sample was incubated with PML polyclonal antibody (Product# PA5-79836) with a dilution of 1 µg/mL, and developed by Streptavidin-Biotin-Complex (SABC) with DAB chromogen method. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          PML Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          PML Antibody in Western Blot (WB)
          PML Antibody in Western Blot (WB)
          PML Antibody in Western Blot (WB)

          Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.

          PML Polyclonal Antibody

          Product Details

          PA5-79836

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of mouse PML Protein (140-177aa LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746951

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: mouse testis tissue. IHC: mouse spleen tissue.

          Target Information

          The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair (NER). This protein was shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, as well as with ubiquitin protein ligase E6AP, and thus suggests that this protein may be involved in the ubiquitin mediated proteolytic pathway in cells.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: E3 SUMO-protein ligase PML; My1 (PML); PML; PML/RARA fusion; pml1; probable transcription factor PML; promyelocytic leukemia protein; promyelocytic leukemia, inducer of; putative; RING finger protein 71; RING-type E3 SUMO transferase PML; tripartite motif protein TRIM19; tripartite motif-containing protein 19; unnamed protein product

          View more View less

          Gene Aliases: 1200009E24Rik; MYL; PP8675; RNF71; TRIM19

          View more View less

          UniProt ID: (Human) P29590, (Mouse) Q60953

          View more View less

          Entrez Gene ID: (Human) 5371, (Mouse) 18854

          View more View less

          Function(s)
          transcription coactivator activity protein binding zinc ion binding SUMO transferase activity ubiquitin protein ligase binding SUMO binding identical protein binding protein homodimerization activity SMAD binding metal ion binding protein heterodimerization activity cobalt ion binding binding, bridging ubiquitin-like protein ligase activity
          Process(es)
          response to hypoxia positive regulation of defense response to virus by host chromatin remodeling regulation of transcription, DNA-templated protein targeting apoptotic process negative regulation of cell proliferation intrinsic apoptotic signaling pathway in response to DNA damage regulation of calcium ion transport into cytosol negative regulation of gene expression fibroblast migration negative regulation of angiogenesis protein sumoylation regulation of cell adhesion negative regulation of cell growth DNA damage response, signal transduction by p53 class mediator PML body organization positive regulation of telomere maintenance negative regulation of telomere maintenance via telomerase endoplasmic reticulum calcium ion homeostasis negative regulation of interleukin-1 beta production negative regulation of interleukin-1 production circadian regulation of gene expression negative regulation of translation in response to oxidative stress response to cytokine protein localization to nucleus regulation of circadian rhythm intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator entrainment of circadian clock by photoperiod proteasome-mediated ubiquitin-dependent protein catabolic process negative regulation by host of viral release from host cell innate immune response establishment of protein localization negative regulation of transcription, DNA-templated positive regulation of transcription, DNA-templated negative regulation of mitotic cell cycle positive regulation of fibroblast proliferation protein stabilization regulation of protein metabolic process maintenance of protein location in nucleus regulation of cell cycle positive regulation of apoptotic process involved in mammary gland involution protein-containing complex assembly cellular senescence oncogene-induced cell senescence antiviral innate immune response positive regulation of signal transduction by p53 class mediator positive regulation of protein localization to chromosome, telomeric region negative regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process regulation of double-strand break repair positive regulation of apoptotic signaling pathway positive regulation of extrinsic apoptotic signaling pathway protein import into nucleus transforming growth factor beta receptor signaling pathway intrinsic apoptotic signaling pathway in response to oxidative stress response to UV response to gamma radiation myeloid cell differentiation cell fate commitment regulation of MHC class I biosynthetic process retinoic acid receptor signaling pathway SMAD protein signal transduction branching involved in mammary gland duct morphogenesis intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress cellular response to interleukin-4 intrinsic apoptotic signaling pathway by p53 class mediator extrinsic apoptotic signaling pathway cellular response to leukemia inhibitory factor positive regulation of peptidyl-lysine acetylation
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Quick Order
          • eProcurement
          • Supply Center
          • Order Status
          • Chemicals
          • India Mobile App
          • Government eMarketplace
          Support Plus Icon Minus Icon
          • Order Support
          • Training
          • Contact Us
          • Report a Site Issue
          • Instrument Management
          Resources Plus Icon Minus Icon
          • Product Selection Guides
          • Mobile & Desktop Apps
          • Webinars
          • Blog 
          • Social Media
          • New Products
          • Promotions
          • Shared Lists
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          India flag icon
          India

          Thermo Fisher Scientific India Pvt Ltd.

          Registered office address:
          402, 403, 404, Delphi 'B' Wing,
          Hiranandani Business Park,
          Powai, Mumbai – 400 076

          Email address: customer.reach@thermofisher.com
          Phone: 1800-2097001
          CIN: U73100MH2000PTC126872

          Invitrogen BioServices (India) Pvt Ltd

          Registered office address:
          First Technology Place, No 3, EPIP,
          Whitefield, Bangalore – 560 079

          Email address: customer.reach@thermofisher.com
          Phone: 1800-2097001
          CIN: U73100KA2004PTC035330

          Your items have has been added!


          Host server : magellan-search-blue-7fb9f846c9-l8rg4:80/100.66.76.64:80.
          git-commit: 8207b5afa5c305bd40e0a4f0b9b53fd46f2a8829
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.59.1-2026.09.91-1.0