Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • PML Antibodies

          Invitrogen

          PML Polyclonal Antibody

          View all (24) PML antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite PML Polyclonal Antibody

          • Antibody Testing Data (4)
          PML Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          PML Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 4

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          PML Antibody (PA5-79836) in IHC (P)

          Immunohistochemistry analysis of PML on paraffin-embedded mouse spleen tissue. Sample was incubated with PML polyclonal antibody (Product# PA5-79836) with a dilution of 1 µg/mL, and developed by Streptavidin-Biotin-Complex (SABC) with DAB chromogen method. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          PML Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          PML Antibody in Western Blot (WB)
          PML Antibody in Western Blot (WB)
          PML Antibody in Western Blot (WB)
          PML Polyclonal Antibody

          Product Details

          PA5-79836

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of mouse PML Protein (140-177aa LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746951

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: mouse testis tissue. IHC: mouse spleen tissue.

          Target Information

          The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair (NER). This protein was shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, as well as with ubiquitin protein ligase E6AP, and thus suggests that this protein may be involved in the ubiquitin mediated proteolytic pathway in cells.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: E3 SUMO-protein ligase PML; PML/RARA fusion; pml1; probable transcription factor PML; Promyelocytic leukemia protein; promyelocytic leukemia, inducer of; Protein PML; RING finger protein 71; RING-type E3 SUMO transferase PML; TRIM19; tripartite motif protein TRIM19; Tripartite motif-containing protein 19

          View more View less

          Gene Aliases: 1200009E24Rik; AI661194; MYL; PML; PP8675; RNF71; TRIM19

          View more View less

          UniProt ID: (Human) P29590, (Mouse) Q60953

          View more View less

          Entrez Gene ID: (Human) 5371, (Mouse) 18854

          View more View less

          Function(s)
          DNA binding protein binding zinc ion binding ubiquitin protein ligase binding SUMO binding protein homodimerization activity SMAD binding transcription coactivator activity metal ion binding protein heterodimerization activity cobalt ion binding
          Process(es)
          response to hypoxia regulation of protein phosphorylation transcription, DNA-templated regulation of transcription, DNA-templated protein complex assembly activation of cysteine-type endopeptidase activity involved in apoptotic process DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest cell cycle arrest transforming growth factor beta receptor signaling pathway common-partner SMAD protein phosphorylation SMAD protein import into nucleus negative regulation of cell proliferation intrinsic apoptotic signaling pathway in response to oxidative stress response to UV response to gamma radiation regulation of calcium ion transport into cytosol fibroblast migration negative regulation of angiogenesis protein sumoylation myeloid cell differentiation regulation of cell adhesion negative regulation of cell growth PML body organization positive regulation of telomere maintenance endoplasmic reticulum calcium ion homeostasis circadian regulation of gene expression response to cytokine regulation of circadian rhythm intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator entrainment of circadian clock by photoperiod proteasome-mediated ubiquitin-dependent protein catabolic process innate immune response cell fate commitment regulation of MHC class I biosynthetic process negative regulation of transcription, DNA-templated positive regulation of fibroblast proliferation retinoic acid receptor signaling pathway negative regulation of interleukin-1 beta secretion maintenance of protein location in nucleus defense response to virus interferon-gamma-mediated signaling pathway branching involved in mammary gland duct morphogenesis intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress cellular response to interleukin-4 cellular senescence extrinsic apoptotic signaling pathway regulation of signal transduction by p53 class mediator negative regulation of viral release from host cell negative regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process regulation of double-strand break repair positive regulation of extrinsic apoptotic signaling pathway positive regulation of defense response to virus by host immune system process protein targeting apoptotic process cell aging intrinsic apoptotic signaling pathway in response to DNA damage viral process positive regulation of histone deacetylation negative regulation of telomere maintenance via telomerase negative regulation of translation in response to oxidative stress negative regulation of mitotic cell cycle rhythmic process negative regulation of interleukin-1 secretion protein stabilization negative regulation of telomerase activity positive regulation of apoptotic process involved in mammary gland involution intrinsic apoptotic signaling pathway by p53 class mediator regulation of nucleic acid-templated transcription positive regulation of apoptotic signaling pathway
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          France flag icon
          France

          Your items have has been added!


          Host server : magellan-search-blue-55ff9ddd88-jhh9h:80/100.66.75.107:80.
          git-commit: d366ff9721d93504b2ac26a183b2b3e3d0e7d9ec
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.42.0-2026.01.03-1.0