Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
            • Instrument Management
          • Primary Antibodies ›
          • PML Antibodies

          Invitrogen

          PML Polyclonal Antibody

          View all (21) PML antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite PML Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (4)
          PML Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          PML Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 4

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          PML Antibody (PA5-79836) in IHC (P)

          Immunohistochemistry analysis of PML on paraffin-embedded mouse spleen tissue. Sample was incubated with PML polyclonal antibody (Product# PA5-79836) with a dilution of 1 µg/mL, and developed by Streptavidin-Biotin-Complex (SABC) with DAB chromogen method. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          PML Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          PML Antibody in Western Blot (WB)
          PML Antibody in Western Blot (WB)
          PML Antibody in Western Blot (WB)
          PML Polyclonal Antibody

          Product Details

          PA5-79836

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of mouse PML Protein (140-177aa LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746951

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: mouse testis tissue. IHC: mouse spleen tissue.

          Target Information

          The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair (NER). This protein was shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, as well as with ubiquitin protein ligase E6AP, and thus suggests that this protein may be involved in the ubiquitin mediated proteolytic pathway in cells.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: E3 SUMO-protein ligase PML; My1 (PML); PML; PML/RARA fusion; pml1; probable transcription factor PML; Promyelocytic leukemia protein; promyelocytic leukemia, inducer of; Protein PML; putative; RING finger protein 71; RING-type E3 SUMO transferase PML; TRIM19; tripartite motif protein TRIM19; Tripartite motif-containing protein 19; unnamed protein product

          View more View less

          Gene Aliases: 1200009E24Rik; AI661194; MYL; PML; PP8675; RNF71; TRIM19

          View more View less

          UniProt ID: (Human) P29590, (Mouse) Q60953

          View more View less

          Entrez Gene ID: (Human) 5371, (Mouse) 18854

          View more View less

          Function(s)
          DNA binding transcription coactivator activity protein binding zinc ion binding transferase activity SUMO transferase activity ubiquitin protein ligase binding SUMO binding identical protein binding protein homodimerization activity SMAD binding metal ion binding protein heterodimerization activity cobalt ion binding binding, bridging ubiquitin-like protein ligase activity
          Process(es)
          response to hypoxia regulation of protein phosphorylation positive regulation of defense response to virus by host immune system process transcription, DNA-templated regulation of transcription, DNA-templated protein complex assembly protein targeting apoptotic process activation of cysteine-type endopeptidase activity involved in apoptotic process DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest cell cycle arrest transforming growth factor beta receptor signaling pathway common-partner SMAD protein phosphorylation SMAD protein import into nucleus cell aging negative regulation of cell proliferation intrinsic apoptotic signaling pathway in response to DNA damage intrinsic apoptotic signaling pathway in response to oxidative stress response to UV response to gamma radiation regulation of calcium ion transport into cytosol viral process negative regulation of angiogenesis myeloid cell differentiation negative regulation of cell growth PML body organization positive regulation of histone deacetylation negative regulation of telomere maintenance via telomerase endoplasmic reticulum calcium ion homeostasis circadian regulation of gene expression negative regulation of translation in response to oxidative stress response to cytokine regulation of circadian rhythm intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator entrainment of circadian clock by photoperiod proteasome-mediated ubiquitin-dependent protein catabolic process innate immune response cell fate commitment regulation of MHC class I biosynthetic process negative regulation of transcription, DNA-templated negative regulation of mitotic cell cycle retinoic acid receptor signaling pathway rhythmic process negative regulation of interleukin-1 secretion negative regulation of interleukin-1 beta secretion protein stabilization maintenance of protein location in nucleus defense response to virus negative regulation of telomerase activity positive regulation of apoptotic process involved in mammary gland involution branching involved in mammary gland duct morphogenesis intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress cellular response to interleukin-4 intrinsic apoptotic signaling pathway by p53 class mediator cellular senescence extrinsic apoptotic signaling pathway negative regulation of viral release from host cell regulation of nucleic acid-templated transcription negative regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process regulation of double-strand break repair positive regulation of apoptotic signaling pathway positive regulation of extrinsic apoptotic signaling pathway chromatin remodeling protein import into nucleus negative regulation of gene expression fibroblast migration protein sumoylation regulation of cell adhesion DNA damage response, signal transduction by p53 class mediator protein complex localization positive regulation of telomere maintenance negative regulation of interleukin-1 beta production negative regulation of interleukin-1 production protein localization to nucleus negative regulation by host of viral release from host cell establishment of protein localization positive regulation of transcription, DNA-templated positive regulation of fibroblast proliferation regulation of protein metabolic process regulation of cell cycle regulation of cellular localization SMAD protein signal transduction protein-containing complex assembly regulation of biological quality oncogene-induced cell senescence positive regulation of signal transduction by p53 class mediator positive regulation of protein localization to chromosome, telomeric region cellular response to leukemia inhibitory factor
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-lnstr:80/100.66.74.145:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline