Search

  • 주문 현황
  • 빠른주문

Invitrogen

PML Polyclonal Antibody

View all (23) PML antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Additional Information:
{{banner.description}}
{{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
PML Polyclonal Antibody

Product Details

PA5-79836

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL
-
Product Specifications

Species Reactivity

Human, Mouse

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of mouse PML Protein (140-177aa LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Amount

100 µg

Purification

Antigen affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2746951

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: mouse testis tissue. IHC: mouse spleen tissue.

Target Information

The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair (NER). This protein was shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, as well as with ubiquitin protein ligase E6AP, and thus suggests that this protein may be involved in the ubiquitin mediated proteolytic pathway in cells.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: E3 SUMO-protein ligase PML; My1 (PML); PML; PML/RARA fusion; pml1; probable transcription factor PML; Promyelocytic leukemia protein; promyelocytic leukemia, inducer of; Protein PML; putative; RING finger protein 71; RING-type E3 SUMO transferase PML; TRIM19; tripartite motif protein TRIM19; Tripartite motif-containing protein 19; unnamed protein product

View more View less

Gene Aliases: 1200009E24Rik; AI661194; MYL; PML; PP8675; RNF71; TRIM19

View more View less

UniProt ID: (Human) P29590, (Mouse) Q60953

View more View less

Entrez Gene ID: (Human) 5371, (Mouse) 18854

View more View less

Function(s)
DNA binding transcription coactivator activity protein binding zinc ion binding transferase activity SUMO transferase activity ubiquitin protein ligase binding SUMO binding identical protein binding protein homodimerization activity SMAD binding metal ion binding protein heterodimerization activity cobalt ion binding binding, bridging ubiquitin-like protein ligase activity
Process(es)
response to hypoxia regulation of protein phosphorylation positive regulation of defense response to virus by host immune system process transcription, DNA-templated regulation of transcription, DNA-templated protein complex assembly protein targeting apoptotic process activation of cysteine-type endopeptidase activity involved in apoptotic process DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest cell cycle arrest transforming growth factor beta receptor signaling pathway common-partner SMAD protein phosphorylation SMAD protein import into nucleus cell aging negative regulation of cell proliferation intrinsic apoptotic signaling pathway in response to DNA damage intrinsic apoptotic signaling pathway in response to oxidative stress response to UV response to gamma radiation regulation of calcium ion transport into cytosol viral process negative regulation of angiogenesis myeloid cell differentiation negative regulation of cell growth PML body organization positive regulation of histone deacetylation negative regulation of telomere maintenance via telomerase endoplasmic reticulum calcium ion homeostasis circadian regulation of gene expression negative regulation of translation in response to oxidative stress response to cytokine regulation of circadian rhythm intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator entrainment of circadian clock by photoperiod proteasome-mediated ubiquitin-dependent protein catabolic process innate immune response cell fate commitment regulation of MHC class I biosynthetic process negative regulation of transcription, DNA-templated negative regulation of mitotic cell cycle retinoic acid receptor signaling pathway rhythmic process negative regulation of interleukin-1 secretion negative regulation of interleukin-1 beta secretion protein stabilization maintenance of protein location in nucleus defense response to virus negative regulation of telomerase activity positive regulation of apoptotic process involved in mammary gland involution branching involved in mammary gland duct morphogenesis intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress cellular response to interleukin-4 intrinsic apoptotic signaling pathway by p53 class mediator cellular senescence extrinsic apoptotic signaling pathway negative regulation of viral release from host cell regulation of nucleic acid-templated transcription negative regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process regulation of double-strand break repair positive regulation of apoptotic signaling pathway positive regulation of extrinsic apoptotic signaling pathway chromatin remodeling protein import into nucleus negative regulation of gene expression fibroblast migration protein sumoylation regulation of cell adhesion DNA damage response, signal transduction by p53 class mediator protein complex localization positive regulation of telomere maintenance negative regulation of interleukin-1 beta production negative regulation of interleukin-1 production protein localization to nucleus negative regulation by host of viral release from host cell establishment of protein localization positive regulation of transcription, DNA-templated positive regulation of fibroblast proliferation regulation of protein metabolic process regulation of cell cycle regulation of cellular localization SMAD protein signal transduction protein-containing complex assembly regulation of biological quality oncogene-induced cell senescence positive regulation of signal transduction by p53 class mediator positive regulation of protein localization to chromosome, telomeric region cellular response to leukemia inhibitory factor
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support