Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Alomone Labs, LTD
PSD-93 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
APZ-002-200UL
Product Specifications
Species Reactivity
Rat,
Mouse
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
GST fusion protein with the sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat Chapsyn-110, Between PDZ2 and PDZ3 domains.
Conjugate
Form
Lyophilized
Concentration
1 mg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS, pH 7.4, with 5% sucrose, 1% BSA
Contains
0.025% sodium azide
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Shipping conditions
Ambient (domestic); Wet ice (international)
Product Specific Information
Reconstitution: 25 µL, 50 µL or 0.2 mL double distilled water (DDW), depending on the sample size. The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20C. The reconstituted solution can be stored at 4C, protected from the light, for up to 1 week. For longer periods, small aliquots should be stored at -20C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 X g 5 min).
Target Information
PSD-93, also known as chapsyn-110, is one of a family of plasma membrane-associated proteins found in synaptic junctions. PSD-93 is unique among family members in its expression in Purkinje neuron cell bodies and dendrites. PSD-93 has three ~90 amino acid repeats called PDZ domains, a single interior SH3 domain, and a carboxyl-terminal guanylate kinase homology (GuK) domain that is enzymatically inactive. It is hypothesized that PDZ-domain interactions play a role in receptor and channel clustering which contributes to neuronal plasticiyt. PSD-93 is believed to participate in the clustering of certain proteins, including NMDA receptors and shaker-type potassium channels at the synaptic membrane. There are two principal modes of interaction between PSD-93 and other proteins. NMDA receptors and shaker-type potassium channels both share C-terminal sequence homology consisting of a threonine/serine-X-valine-COOH (T/SXV) motif. Other neuronal proteins that share this motif may interact with PSD-93 by binding to its PDZ domains. Neuronal nitric oxide synthase (nNOS), which lacks the T/SXV motif but which has its own PDZ domain, has been shown to associate with PSD-93 in vitro through a pseudo-homotypic PDZ-PDZ interaction.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Channel-associated protein of synapse-110; Chapsyn-1; Chapsyn-110; discs large homolog 2; Disks large homolog 2; Postsynaptic density protein PSD-93; synaptic density protein PSD-93
Gene Aliases: A330103J02Rik; B230218P12Rik; B330007M19Rik; Dlg2; Dlgh2; Gm1197; PSD93
UniProt ID: (Mouse) Q91XM9, (Rat) Q63622
Entrez Gene ID: (Mouse) 23859, (Rat) 64053
chemical synaptic transmission
nervous system development
negative regulation of phosphatase activity
sensory perception of pain
receptor clustering
neuronal ion channel clustering
nucleotide phosphorylation
receptor localization to synapse
establishment or maintenance of epithelial cell apical/basal polarity
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support