Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • PSD93 Antibodies

          Alomone Labs, LTD

          PSD-93 Polyclonal Antibody

          View all (25) PSD93 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite PSD-93 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          PSD-93 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          PSD-93 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          PSD-93 Antibody (APZ-002-200UL) in WB

          Western blot analysisof rat brain membranes: - 1. Anti-PSD-93 Antibody (#APZ-002), (1:1000).2. Anti-PSD-93 Antibody , preincubated with PSD-93 Blocking Peptide (#BLP-PZ002). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          PSD-93 Antibody in Western Blot (WB)
          PSD-93 Polyclonal Antibody

          Product Details

          APZ-002-200UL

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          1:100
          -
          Product Specifications

          Species Reactivity

          Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          GST fusion protein with the sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat Chapsyn-110, Between PDZ2 and PDZ3 domains.
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          1 mg/mL

          Amount

          200 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS, pH 7.4, with 5% sucrose, 1% BSA

          Contains

          0.025% sodium azide

          Storage conditions

          -20°C, Avoid Freeze/Thaw Cycles

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          Product Specific Information

          Reconstitution: 25 µL, 50 µL or 0.2 mL double distilled water (DDW), depending on the sample size. The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20C. The reconstituted solution can be stored at 4C, protected from the light, for up to 1 week. For longer periods, small aliquots should be stored at -20C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 X g 5 min).

          Target Information

          PSD-93, also known as chapsyn-110, is one of a family of plasma membrane-associated proteins found in synaptic junctions. PSD-93 is unique among family members in its expression in Purkinje neuron cell bodies and dendrites. PSD-93 has three ~90 amino acid repeats called PDZ domains, a single interior SH3 domain, and a carboxyl-terminal guanylate kinase homology (GuK) domain that is enzymatically inactive. It is hypothesized that PDZ-domain interactions play a role in receptor and channel clustering which contributes to neuronal plasticiyt. PSD-93 is believed to participate in the clustering of certain proteins, including NMDA receptors and shaker-type potassium channels at the synaptic membrane. There are two principal modes of interaction between PSD-93 and other proteins. NMDA receptors and shaker-type potassium channels both share C-terminal sequence homology consisting of a threonine/serine-X-valine-COOH (T/SXV) motif. Other neuronal proteins that share this motif may interact with PSD-93 by binding to its PDZ domains. Neuronal nitric oxide synthase (nNOS), which lacks the T/SXV motif but which has its own PDZ domain, has been shown to associate with PSD-93 in vitro through a pseudo-homotypic PDZ-PDZ interaction.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: Channel-associated protein of synapse-110; Chapsyn-1; Chapsyn-110; discs large homolog 2; Disks large homolog 2; Postsynaptic density protein PSD-93; synaptic density protein PSD-93

          View more View less

          Gene Aliases: A330103J02Rik; B230218P12Rik; B330007M19Rik; Dlg2; Dlgh2; Gm1197; PSD93

          View more View less

          UniProt ID: (Mouse) Q91XM9, (Rat) Q63622

          View more View less

          Entrez Gene ID: (Mouse) 23859, (Rat) 64053

          View more View less

          Function(s)
          guanylate kinase activity protein binding protein C-terminus binding kinase binding protein phosphatase binding PDZ domain binding ionotropic glutamate receptor binding protein heterodimerization activity scaffold/adaptor protein
          Process(es)
          chemical synaptic transmission nervous system development negative regulation of phosphatase activity sensory perception of pain receptor clustering neuronal ion channel clustering nucleotide phosphorylation receptor localization to synapse establishment or maintenance of epithelial cell apical/basal polarity
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-5cvsx:80/100.66.79.163:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline