Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
PTP4A2 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 5
PTP4A2 Antibody (PA5-79893) in IHC (P)
Immunohistochemistry analysis of PTP4A2 on paraffin-embedded human prostatic cancer tissue. Antigen retrieval was performed using citrate buffer (pH6, epitope retrieval solution) for 20 mins. Sample was blocked using 10% goat serum, incubated with PTP4A2 polyclonal antibody (Product# PA5-79893) with a dilution of 1 µg/mL (overnight at 4°C), and followed by biotinylated goat anti-rabbit IgG (30 minutes at 37... View More
Product Details
PA5-79893
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2 (40-69aa TTLVRVCDATYDKAPVEKEGIHVLDWPFDD).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human MOLT-4 whole cell, human T-47D whole cell, human Daudi whole cell, human RT4 whole cell, rat PC-12 whole cell. IHC: Human Prostatic Cancer tissue. Flow: U937 cell, MCF-7 cell, A431 cell.
Target Information
PRL-2, also known as Protein tyrosine phosphatase 4a2 (Ptp4a2) is a unique nuclear protein tyrosine phosphatase (PTP) that plays a central role in regulating diverse cellular processes. PRL-1 is induced in mitogen-stimulated cells and regenerating liver. PRL-2 exhibits 87% identity to PRL-1 in their amino acid sequences. All mouse PRL proteins contain a C-terminal consensus sequence for prenylation. All PRL proteins bear significant sequence homology to Cdc14p and the tumor suppressor PTEN/MMAC1. PRL-2 is preferentially expressed in skeletal muscle. PRL-2 is also expressed at lower levels in other tissues.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: HU-PP-1; OV-1; phosphatase of regenerating liver 2; PRL-2; protein tyrosine phosphatase 4a2; protein tyrosine phosphatase IVA; protein tyrosine phosphatase IVA2; Protein tyrosine phosphatase type IVA 2; Protein-tyrosine phosphatase 4a2; Protein-tyrosine phosphatase of regenerating liver 2; PTP(CAAXII); tyrosine-phosphatase
Gene Aliases: BM-008; HH13; HH7-2; HU-PP-1; OV-1; PRL-2; PRL2; ptp-IV1a; ptp-IV1b; PTP4A; PTP4A2; PTPCAAX2
UniProt ID: (Human) Q12974, (Rat) Q6P9X4
Entrez Gene ID: (Human) 8073, (Rat) 85237
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support