Search
Search
Invitrogen
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
The synthetic peptide sequence is 1-42aa, MDQREILQKFLDEAQSKKITKEEFANEFLKLKRQSTKYKADK
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
The protein tyrosine phosphatase PTPN22 (PTP22, LYP, PEP, formerly PTPN8) is a genetic variant that confers risk of developing diverse human autoimmune diseases such as type 1 diabetes and rheumatoid arthritis. The minor allele of a missense SNP in PTPN22 encodes a hematopoietic-specific protein tyrosine phosphatase also known as "Lyp." The risk allele is present in about 17% of Caucasian individuals from the general population and in approximately 28% of Caucasian individuals with rheumatoid arthritis; it is thought to disrupt the P1 proline-rich motif that is important for interaction with the Src homology-3 (SH3) domain of CSK (cytoplasmic tyrosine kinase), potentially altering the normal functions of these proteins as negative regulators of T cell activation. The interaction between CSK and PTPN22 is highly specific and it is speculated that PTPN22 may be an effector and/or regulator of CSK in T cells and other hematopoietic cells.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support