Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence of human Rad51. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807381 |
Synthetic peptide sequence: KKLEEAGFHTVEAVAYAPKKELINIKGISEAKADK.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
RAD51 plays a critical role in homologous strand exchange, a key step in DNA repair through homologous recobination. It binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity. RAD51 catalyzes the recognition of homology and strand exchange between homologous DNA partners to form a joint molecule between a processed DNA break and the repair template. It binds to a single-stranded DNA in an ATP-dependent manner to form nucleoprotein filaments which are essential for the homology search and strand exchange. Mutations in the gene can results in breast cancer, mirror movements 2 and fanconi anemia.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: BRCA1/BRCA2-containing complex, subunit 5; DNA repair protein RAD51 homolog 1; HsRAD51; RAD51 homolog; RAD51 homolog A; RecA, E. coli, homolog of; RecA-like protein; recombination protein A
Gene Aliases: AV304093; BRCC5; FANCR; HRAD51; HsRad51; HsT16930; MRMV2; RAD51; RAD51A; RECA; RGD1563603
UniProt ID: (Human) Q06609, (Mouse) Q08297
Entrez Gene ID: (Human) 5888, (Mouse) 19361, (Rat) 499870
Molecular Function:
DNA metabolism protein
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support