Search

  • Fale Conosco
  • Pedido rápido

Invitrogen

RAD51 Polyclonal Antibody

View all (42) RAD51 antibodies

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Datasheet
Certificates
Protocols
Questions & Answers
Tech Support
Additional Information:
{{banner.description}}
{{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
RAD51 Polyclonal Antibody

Product Details

PA5-95579

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL
-

Immunocytochemistry (ICC/IF)

2 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-
Product Specifications

Species Reactivity

Human, Mouse, Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence of human Rad51 (KKLEEAGFHTVEAVAYAPKKELINIKGISEAKADK).
3D Epitope / Immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Amount

100 µg

Purification

Affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2807381

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: human Hela whole cell, human A431 whole cell, human 293T whole cell, human K562 whole cell, human Jurkat whole cell, human A549 whole cell, human Caco-2 whole cell, rat testis tissue, mouse testis tissue, mouse thymus tissue. IHC: human placenta tissue, human testis tissue, mouse brain tissue, rat brain tissue. ICC/IF: U20S cell. Flow: SiHa cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Target Information

RAD51 plays a critical role in homologous strand exchange, a key step in DNA repair through homologous recobination. It binds to single and double-stranded DNA and exhibits DNA-dependent ATPase activity. RAD51 catalyzes the recognition of homology and strand exchange between homologous DNA partners to form a joint molecule between a processed DNA break and the repair template. It binds to a single-stranded DNA in an ATP-dependent manner to form nucleoprotein filaments which are essential for the homology search and strand exchange. Mutations in the gene can results in breast cancer, mirror movements 2 and fanconi anemia.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: BRCA1/BRCA2-containing complex, subunit 5; DNA repair protein RAD51 homolog 1; HsRAD51; RAD51; RAD51 homolog; RAD51 homolog A; RecA, E. coli, homolog of; RecA-like protein; recombination protein A; unnamed protein product

View more View less

Gene Aliases: AV304093; BRCC5; FANCR; HRAD51; HsRad51; HsT16930; MRMV2; RAD51; RAD51A; RECA; RGD1563603

View more View less

UniProt ID: (Human) Q06609, (Mouse) Q08297

View more View less

Entrez Gene ID: (Human) 5888, (Mouse) 19361, (Rat) 499870

View more View less

Function(s)
recombinase activity nucleotide binding DNA binding chromatin binding double-stranded DNA binding single-stranded DNA binding protein binding ATP binding DNA-dependent ATPase activity single-stranded DNA-dependent ATP-dependent DNA helicase activity enzyme binding identical protein binding DNA polymerase binding ATP-dependent DNA damage sensor activity damaged DNA binding protein C-terminus binding single-stranded DNA-dependent ATPase activity molecular_function DNA metabolism protein
Process(es)
telomere maintenance via recombination double-strand break repair via homologous recombination DNA recombinase assembly DNA metabolic process DNA repair DNA recombination mitotic recombination cellular response to DNA damage stimulus meiosis I reciprocal meiotic recombination response to xenobiotic stimulus response to toxic substance response to X-ray regulation of double-strand break repair via homologous recombination telomere maintenance via telomere lengthening replication fork processing telomere organization interstrand cross-link repair strand invasion meiotic cell cycle chromosome organization involved in meiotic cell cycle cellular response to alkaloid cellular response to ionizing radiation cellular response to gamma radiation cellular response to hydroxyurea cellular response to cisplatin cellular response to camptothecin response to glucoside replication-born double-strand break repair via sister chromatid exchange mitotic recombination-dependent replication fork processing double-strand break repair involved in meiotic recombination regulation of DNA damage checkpoint regulation of protein phosphorylation DNA unwinding involved in DNA replication meiotic nuclear division positive regulation of DNA ligation protein homooligomerization response to drug
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support