Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Productos
    • Anticuerpos
    • Oligonucleótidos, cebadores, sondas y genes
    • Ensayos de PCR en tiempo real TaqMan
    • Medios de cultivos celulares
    • Productos químicos
    • Columnas y cartuchos de cromatografía
    • Equipo de laboratorio
    • Material de plástico y suministros para laboratorio
    • Microplacas
    • Productos más ecológicos
    • Ver todas las categorías de productos
  • Applications
    • Bioprocesamiento
    • Cultivo celular y transfección
    • Terapia celular y génica
    • Cromatografía
    • Pruebas moleculares
    • Soluciones digitales
    • Extracción y análisis de ADN y ARN
    • Espectroscopía, análisis elemental y de isótopos
    • Ver todas las aplicaciones y técnicas
  • Servicios
    • Servicios 360° de CDMO y CRO
    • Servicios de CDMO
    • Servicios de CRO
    • Servicios personalizados
    • Servicios de leasing y financiación
    • Servicios de instrumentos
    • Informática de laboratorio
    • OEM y oferta comercial
    • Servicios de formación
    • Unity Lab Services
    • Ver todos los servicios
  • Ayuda y soporte técnico
    • Regístrese para obtener una cuenta
    • Cómo hacer un pedido
    • Asistencia para el instrumental
    • Centros de soporte técnico
    • Centros de formación
    • Vea todos los temas de ayuda y soporte técnico
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • A quiénes brindamos nuestros servicios
    • Industria biotecnológica
    • Sector biofarmacéutico
    • CDMO
    • Diagnósticos de laboratorio
    • Ciencias aplicadas e industriales
  • Promociones
  • Contacto
  • Pedido rápido
  • Estado del pedido y seguimiento
  • Documentos y certificados
Thermo Fisher Scientific Logo

Search

Buscar
Search button
          • Estado del pedido
          • Pedido rápido
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Cuenta
            • Pedidos
            • Connect: laboratorio, datos, aplicaciones
            • Productos y proyectos personalizados
            • Services Central
          • Primary Antibodies ›
          • RXFP2 Antibodies

          Invitrogen

          RXFP2 Polyclonal Antibody

          View all (11) RXFP2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite RXFP2 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (2)
          RXFP2 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          RXFP2 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          RXFP2 Antibody (PA5-95582) in WB

          Western blot analysis of RXFP2 in Lane 1: human SHG-44 whole cell lysate. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with RXFP2 polyclonal antibody (Product # PA5-95582) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution of 1:10,000, and developed with enhanced chemiluminescence (ECL). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          RXFP2 Antibody in Western Blot (WB)
          RXFP2 Antibody in Flow Cytometry (Flow)
          RXFP2 Polyclonal Antibody

          Product Details

          PA5-95582

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence of human GPCR LGR8 (MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807384

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human SHG-44 whole cell. Flow: U251 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          The activity of this relaxin receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP and may also be a receptor for Leydig insulin-like peptide. Expressed in embryonic and adult gonads of males and females, as well in male gubernarculum and in brain. Not detected in kidney, spleen and heart.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: G protein coupled receptor affecting testicular descent; G-protein coupled receptor 106; G-protein coupled receptor affecting testicular descent; GREAT; Leucine-rich repeat-containing G-protein coupled receptor 8; Relaxin family peptide receptor 2; Relaxin receptor 2; relaxin/insulin like family peptide receptor 2

          View more View less

          Gene Aliases: GPR106; GREAT; INSL3R; LGR8; LGR8.1; RXFP2; RXFPR2

          View more View less

          UniProt ID: (Human) Q8WXD0

          View more View less

          Entrez Gene ID: (Human) 122042

          View more View less

          Function(s)
          G-protein coupled receptor activity G-protein coupled peptide receptor activity protein-hormone receptor activity peptide hormone binding
          Process(es)
          oocyte maturation signal transduction G-protein coupled receptor signaling pathway adenylate cyclase-activating G-protein coupled receptor signaling pathway adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway negative regulation of cell proliferation male gonad development hormone-mediated signaling pathway negative regulation of apoptotic process
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Pedidos Plus Icon Minus Icon
          • Estado del pedido
          • Ayuda con el pedido
          • Pedido rápido
          • Centro de suministros
          • eProcurement (B2B)
          Asistencia Plus Icon Minus Icon
          • Ayuda y soporte técnico
          • Contacto
          • Centros de soporte técnico
          • Documentos y certificados
          • Informar de un problema del sitio web
          Recursos Plus Icon Minus Icon
          • Centros de formación
          • Promociones
          • Eventos y seminarios web
          • Redes sociales
          Acerca de Thermo Fisher Plus Icon Minus Icon
          • Acerca de nosotros Acerca de nosotros
          • Carreras profesionales Carreras profesionales
          • Inversores Inversores
          • Noticias Noticias
          • Responsabilidad social Responsabilidad social
          • Marcas registradas
          • Políticas y avisos
          Nuestra cartera Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Spain flag icon
          Spain

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-n9r8p:80/100.66.76.150:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline