Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • RbAp48 Antibodies

          Invitrogen

          RbAp48 Polyclonal Antibody

          1 Reference
          View all (21) RbAp48 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite RbAp48 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (13)
          RbAp48 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          RbAp48 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 13

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          RbAp48 Antibody (PA5-95325) in ICC/IF

          Immunocytochemistry/Immunofluorescence analysis of RbAp48 in U2OS cell using RbAp48 Polyclonal Antibody (Product # PA5-95325). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 2 µg/mL and mouse anti-Beta Tubulin antibody overnight at 4°C. DyLight 488 conjugated goat anti-rabbit IgG and DyLight 594 conjugated goat anti-mouse IgG were used as secondary antibody at 1:500 dilution and incubated for 30 minutes at 3... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          RbAp48 Antibody in Immunocytochemistry (ICC/IF)
          RbAp48 Antibody in Immunocytochemistry (ICC/IF)
          RbAp48 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RbAp48 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RbAp48 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RbAp48 Antibody in Immunohistochemistry (Frozen) (IHC (F))
          RbAp48 Antibody in Immunohistochemistry (Frozen) (IHC (F))
          RbAp48 Antibody in Immunohistochemistry (Frozen) (IHC (F))
          RbAp48 Antibody in Immunohistochemistry (Frozen) (IHC (F))
          RbAp48 Antibody in Western Blot (WB)
          RbAp48 Antibody in Western Blot (WB)
          RbAp48 Antibody in Western Blot (WB)
          RbAp48 Antibody in Flow Cytometry (Flow)
          RbAp48 Polyclonal Antibody

          Product Details

          PA5-95325

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunohistochemistry (Frozen) (IHC (F))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          2 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -

          ChIP assay (ChIP)

          -
          View 1 publication 1 publication
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Human

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807128

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Hela whole cell, human Raji whole cell, human Jurkat whole cell, human U87 whole cell, human HepG2 whole cell, human K562 whole cell, human RT4 whole cell, human A549 whole cell, rat brain tissue, rat liver tissue, rat lung tissue, rat RH35 whole cell, mouse brain tissue, mouse liver tissue, mouse lung tissue, mouse HEPA1-6 whole cell, rat brain tissue, rat liver tissue, rat lung tissue, rat RH35 whole cell, mouse brain tissue, mouse liver tissue, mouse liver tissue, mouse lung tissue, mouse HEPA1-6 whole cell. IHC: Human Intestinal Cancer tissue, Mouse Liver tissue, Rat Intestine tissue IHC-F: mouse small intestine tissue, rat small intestine tissue, mouse liver tissue, human placenta tissue. ICC/IF: U2OS cell, A431 cell. Flow: 293T cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          RbAp48-11G10 recognizes full length RbAp48, a 48 kDa nuclear protein first isolated by its ability to interact with the carboxyl-terminus of the retinoblastoma protein (Rb). It is a member of the WD (Trp-Asp) repeat family of proteins. RbAp48 is one of the three subunits of CAF-1, can bind to histone H4 and is a subunit of human histone deacetylase HD1.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: CAF-1 p48 subunit; CAF-1 subunit C; CAF-I 48 kDa subunit; CAF-I p48; Chromatin assembly factor 1 subunit C; Chromatin assembly factor I p48 subunit; chromatin assembly factor/CAF-1 p48 subunit; Histone-binding protein RBBP4; MSI1 protein homolog; Nucleosome-remodeling factor subunit RBAP48; RBBP-4; Retinoblastoma-binding protein 4; Retinoblastoma-binding protein p48; unnamed protein product

          View more View less

          Gene Aliases: lin-53; mRbAp48; NURF55; RBAP48; RBBP4

          View more View less

          UniProt ID: (Human) Q09028, (Mouse) Q60972

          View more View less

          Entrez Gene ID: (Human) 5928, (Rat) 313048, (Mouse) 19646

          View more View less

          Function(s)
          RNA polymerase II core promoter proximal region sequence-specific DNA binding protein binding DNA-dependent ATPase activity nucleosomal DNA binding histone binding histone deacetylase binding RNA polymerase II distal enhancer sequence-specific DNA binding molecular_function
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter DNA replication DNA repair chromatin organization nucleosome assembly DNA replication-dependent nucleosome assembly chromatin remodeling regulation of transcription, DNA-templated cellular response to DNA damage stimulus brain development negative regulation of cell proliferation negative regulation of cell migration negative regulation of transforming growth factor beta receptor signaling pathway regulation of cell fate specification negative regulation of transcription, DNA-templated positive regulation of transcription, DNA-templated negative regulation of stem cell population maintenance positive regulation of stem cell population maintenance regulation of stem cell differentiation DNA replication-independent nucleosome assembly metabolic process chromatin assembly ATP-dependent chromatin remodeling response to growth hormone transcription, DNA-templated cell cycle chromatin modification
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-blue-67655d8755-zsnhf:80/100.66.75.14:80.
          git-commit: dddaa802cd395f65bf1581942d0e97a089c38f41
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.46.0-Offline