Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • RhoB Antibodies

          Invitrogen

          RhoB Polyclonal Antibody

          View all (15) RhoB antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Protocols
          Questions & Answers
          Tech Support

          Cite RhoB Polyclonal Antibody

          • Antibody Testing Data (4)
          RhoB Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          RhoB Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 4

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          RhoB Antibody (PA5-95631) in ICC/IF

          Immunocytochemistry analysis of RHOB using anti-RHOB antibody (Product # PA5-95631) . RHOB was detected in an immunocytochemical section of U2OS cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 5 μg/mL rabbit anti-RHOB antibody (Product # PA5-95631) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was countersta... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          RhoB Antibody in Immunocytochemistry (ICC/IF)
          RhoB Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RhoB Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          RhoB Antibody in Western Blot (WB)
          RhoB Polyclonal Antibody

          Product Details

          PA5-95631

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Non-human primate, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence of human RHOB (NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLE).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807433

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Hela whole cell, rat brain tissue, rat C6 whole cell, mouse brain tissue, monkey COS-7 whole cell. IHC: human renal cancer tissue, human mammary cancer tissue. ICC/IF: U20S cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Rho-related GTP-binding protein (RhoB) mediates apoptosis in neoplastically transformed cells after DNA damage. While not essential for development, it does affect cell adhesion and growth factor signaling in transformed cells. RhoB targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a tumor supressor - deletion of RhoB causes tumor formation.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: Aplysia RAS-related homolog 6; aplysia ras-related homolog B; h6; oncogene RHO H6; ras homolog B; ras homolog gene family, member AB; ras homolog gene family, member B; Rho; Rho cDNA clone 6; Rho-related GTP-binding protein RhoB; rhoB

          View more View less

          Gene Aliases: AA017882; ARH6; ARHB; MST081; MSTP081; RHOB; RHOH6

          View more View less

          UniProt ID: (Human) P62745, (Rat) P62747, (Mouse) P62746

          View more View less

          Entrez Gene ID: (Human) 388, (Rat) 64373, (Mouse) 11852

          View more View less

          Function(s)
          GTPase activity protein binding GTP binding GDP binding nucleotide binding small GTPase
          Process(es)
          cytokinesis angiogenesis intracellular protein transport apoptotic process cell adhesion Rho protein signal transduction endosome to lysosome transport positive regulation of endothelial cell migration cell differentiation platelet activation regulation of cell migration negative regulation of cell migration positive regulation of apoptotic process positive regulation of angiogenesis negative regulation of cell cycle regulation of small GTPase mediated signal transduction endothelial tube morphogenesis cellular response to hydrogen peroxide cellular response to ionizing radiation obsolete transformed cell apoptotic process small GTPase mediated signal transduction transport multicellular organism development protein transport
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-55658555d6-qfdf2:80/100.66.76.55:80.
          git-commit: ec8e7df5f8fec8d765bd419205f1b5046a016d37
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.41.0-Offline