Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • SCN11A Antibodies

          Invitrogen

          SCN11A Polyclonal Antibody

          View all (12) SCN11A antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite SCN11A Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (5)
          SCN11A Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          SCN11A Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 5

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          SCN11A Antibody (PA5-114378) in IHC (P)

          Immunohistochemistry analysis of SCN11A in paraffin-embedded mouse spleen tissue. Antigen retrieval was performed with EDTA buffer (pH 8.0, epitope retrieval solution). Samples were blocked with 10% goat serum and incubated in SCN11A polyclonal antibody (Product # PA5-114378) at a dilution of 1 µg/mL (overnight, 4°C), followed by biotinylated goat anti-rabbit IgG (30 min, 37°C) and Strepavidin-Biotin-Comple... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          SCN11A Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SCN11A Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SCN11A Antibody in Western Blot (WB)
          SCN11A Antibody in Flow Cytometry (Flow)
          SCN11A Antibody in Flow Cytometry (Flow)
          SCN11A Polyclonal Antibody

          Product Details

          PA5-114378

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.25-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence of human SCN11A (MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKKK).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2884834

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human PC-3 whole cell, rat brain tissue, rat kidney tissue, rat C6 whole cell, mouse spleen tissue, mouse brain tissue, mouse kidney tissue. IHC: rat spleen tissue, mouse spleen tissue. Flow: U87 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Epithelial sodium channels are amiloride-sensitive members of the Degenerin/epithelial sodium channel (Deg/ENaC) superfamily of ion channels. Members of this superfamily of ion channels share organizational similarity in that they all possess two short intracellular amino and carboxyl termini, two short membrane spanning segments, and a large extracellular loop with a conserved cysteine-rich region. There are three homologous isoforms of the ENaC (alpha, beta, and gamma) protein. ENaC in the kidney, lung, and colon plays an essential role in trans-epithelial sodium and fluid balance. ENaC also mediates aldosterone-dependent sodium reabsorption in the distal nephron of the kidney, thus regulating blood pressure. ENaC is thought to be regulated, in part, through association with the cystic fibrosis transmembrane conductance regulator (CFTR) chloride ion channel. Gain-of-function mutations in beta- or gamma-ENaC can cause severe arterial hypertension (Liddels syndrome) and loss-of-function mutations in alpha- or beta-ENaC causes pseudohypoaldosteronism (PHA-1).

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: hNaN; NaN; NaN alpha subunit; Peripheral nerve sodium channel 5; PN5; Sensory neuron sodium channel 2; Sodium channel protein type 11 subunit alpha; Sodium channel protein type XI subunit alpha; sodium channel voltage-gated type 11 alpha polypeptide; sodium channel voltage-gated type XI alpha polypeptide; sodium channel, voltage-gated, type 11, alpha polypeptide; sodium channel, voltage-gated, type XI, alpha; sodium channel, voltage-gated, type XI, alpha polypeptide; sodium channel, voltage-gated, type XI, alpha subunit; sodium channel, voltage-gated, type XII, alpha polypeptide; sodium channel, voltage-gated, type11, alpha polypeptide; voltage-gated sodium channel NAV1.9b; Voltage-gated sodium channel subunit alpha Nav1.9

          View more View less

          Gene Aliases: FEPS3; HSAN7; NaN; NaT; NAV1.9; NSS2; PN5; SCN11A; SCN12A; SNS-2; SNS2

          View more View less

          UniProt ID: (Human) Q9UI33, (Rat) O88457, (Mouse) Q9R053

          View more View less

          Entrez Gene ID: (Human) 11280, (Rat) 29701, (Mouse) 24046

          View more View less

          Function(s)
          ion channel activity voltage-gated sodium channel activity cation channel activity sodium channel activity protein binding voltage-gated ion channel activity voltage-gated ion channel
          Process(es)
          action potential thigmotaxis acute inflammatory response chronic inflammatory response ion transport sodium ion transport inflammatory response G-protein coupled receptor signaling pathway axonogenesis circadian rhythm chemosensory behavior response to heat response to cold response to xenobiotic stimulus response to toxic substance response to high light intensity response to auditory stimulus transmission of nerve impulse neuronal action potential sensory perception of pain ion transmembrane transport response to prostaglandin E sodium ion transmembrane transport thermosensory behavior regulation of membrane potential mast cell degranulation response to pain behavioral response to pain cell motility detection of temperature stimulus involved in sensory perception of pain detection of mechanical stimulus involved in sensory perception of pain detection of mechanical stimulus involved in sensory perception establishment of localization in cell transmembrane transport reflex micturition skeletal muscle organ development artery development behavioral response to acetic acid induced pain behavioral response to formalin induced pain cellular response to cold calcium ion transmembrane transport response to nitric oxide cardiac muscle cell action potential involved in contraction membrane depolarization during action potential action potential initiation cAMP/PKA signal transduction sensory perception of itch calcitonin gene-related peptide receptor signaling pathway small intestine smooth muscle contraction regulation of ion transmembrane transport regulation of sensory perception of pain transport
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Spain flag icon
          Spain

          TEST

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-8dsbr:80/100.66.76.150:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline