Search
Invitrogen
SCN11A Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 5
SCN11A Antibody (PA5-114378) in IHC (P)
Immunohistochemistry analysis of SCN11A in paraffin-embedded mouse spleen tissue. Antigen retrieval was performed with EDTA buffer (pH 8.0, epitope retrieval solution). Samples were blocked with 10% goat serum and incubated in SCN11A polyclonal antibody (Product # PA5-114378) at a dilution of 1 µg/mL (overnight, 4°C), followed by biotinylated goat anti-rabbit IgG (30 min, 37°C) and Strepavidin-Biotin-Comple... View More
Product Details
PA5-114378
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human SCN11A (MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKKK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human PC-3 whole cell, rat brain tissue, rat kidney tissue, rat C6 whole cell, mouse spleen tissue, mouse brain tissue, mouse kidney tissue. IHC: rat spleen tissue, mouse spleen tissue. Flow: U87 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Epithelial sodium channels are amiloride-sensitive members of the Degenerin/epithelial sodium channel (Deg/ENaC) superfamily of ion channels. Members of this superfamily of ion channels share organizational similarity in that they all possess two short intracellular amino and carboxyl termini, two short membrane spanning segments, and a large extracellular loop with a conserved cysteine-rich region. There are three homologous isoforms of the ENaC (alpha, beta, and gamma) protein. ENaC in the kidney, lung, and colon plays an essential role in trans-epithelial sodium and fluid balance. ENaC also mediates aldosterone-dependent sodium reabsorption in the distal nephron of the kidney, thus regulating blood pressure. ENaC is thought to be regulated, in part, through association with the cystic fibrosis transmembrane conductance regulator (CFTR) chloride ion channel. Gain-of-function mutations in beta- or gamma-ENaC can cause severe arterial hypertension (Liddels syndrome) and loss-of-function mutations in alpha- or beta-ENaC causes pseudohypoaldosteronism (PHA-1).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: hNaN; NaN; NaN alpha subunit; Peripheral nerve sodium channel 5; PN5; Sensory neuron sodium channel 2; Sodium channel protein type 11 subunit alpha; Sodium channel protein type XI subunit alpha; sodium channel voltage-gated type 11 alpha polypeptide; sodium channel voltage-gated type XI alpha polypeptide; sodium channel, voltage-gated, type 11, alpha polypeptide; sodium channel, voltage-gated, type XI, alpha; sodium channel, voltage-gated, type XI, alpha polypeptide; sodium channel, voltage-gated, type XI, alpha subunit; sodium channel, voltage-gated, type XII, alpha polypeptide; sodium channel, voltage-gated, type11, alpha polypeptide; voltage-gated sodium channel NAV1.9b; Voltage-gated sodium channel subunit alpha Nav1.9
Gene Aliases: FEPS3; HSAN7; NaN; NaT; NAV1.9; NSS2; PN5; SCN11A; SCN12A; SNS-2; SNS2
UniProt ID: (Human) Q9UI33, (Rat) O88457, (Mouse) Q9R053
Entrez Gene ID: (Human) 11280, (Rat) 29701, (Mouse) 24046
action potential
thigmotaxis
acute inflammatory response
chronic inflammatory response
ion transport
sodium ion transport
inflammatory response
G-protein coupled receptor signaling pathway
axonogenesis
circadian rhythm
chemosensory behavior
response to heat
response to cold
response to xenobiotic stimulus
response to toxic substance
response to high light intensity
response to auditory stimulus
transmission of nerve impulse
neuronal action potential
sensory perception of pain
ion transmembrane transport
response to prostaglandin E
sodium ion transmembrane transport
thermosensory behavior
regulation of membrane potential
mast cell degranulation
response to pain
behavioral response to pain
cell motility
detection of temperature stimulus involved in sensory perception of pain
detection of mechanical stimulus involved in sensory perception of pain
detection of mechanical stimulus involved in sensory perception
establishment of localization in cell
transmembrane transport
reflex
micturition
skeletal muscle organ development
artery development
behavioral response to acetic acid induced pain
behavioral response to formalin induced pain
cellular response to cold
calcium ion transmembrane transport
response to nitric oxide
cardiac muscle cell action potential involved in contraction
membrane depolarization during action potential
action potential initiation
cAMP/PKA signal transduction
sensory perception of itch
calcitonin gene-related peptide receptor signaling pathway
small intestine smooth muscle contraction
regulation of ion transmembrane transport
regulation of sensory perception of pain
transport
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support