Sequence of this protein is as follows: CNINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQVVGFQLCSNDTSDCATYTFSSGINAIQEWYKLHYMNIMAQVPLEKKINMS
Epithelial sodium channels are amiloride-sensitive members of the degenerin/epithelial sodium channel (Deg/ENaC) superfamily of ion channels. Members of this superfamily of ion channels share organizational similarity in that they all possess two short intracellular amino and carboxyl termini, two short membrane spanning segments, and a large extracellular loop with a conserved cysteine-rich region. There are three homologous isoforms of the ENaC (alpha, beta, and gamma) protein. ENaC in the kidney, lung, and colon plays an essential role in trans-epithelial sodium and fluid balance. ENaC also mediates aldosterone-dependent sodium reabsorption in the distal nephron of the kidney, thus regulating blood pressure. ENaC is thought to be regulated, in part, through association with the cystic fibrosis transmembrane conductance regulator (CFTR) chloride ion channel. Gain-of-function mutations in beta- or gamma-ENaC can cause severe arterial hypertension (Liddel's syndrome) and loss-of-function mutations in alpha- or beta-ENaC causes pseudohypoaldosteronism (PHA-1).
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: amiloride sensitive sodium channel gamma1 subunit; amiloride-sensitive epithelial sodium channel gamma subunit; amiloride-sensitive sodium channel gamma-subunit; Amiloride-sensitive sodium channel subunit gamma; ENaC gamma; ENaC gamma subunit; ENaCG; Epithelial Na(+) channel subunit gamma; epithelial sodium channel gamma subunit; Gamma ENaC; Gamma NaCH; Gamma-ENaC; Gamma-NaCH; Nonvoltage-gated sodium channel 1 subunit gamma; PHA 1; SCNEG; SCNN 1G; sodium channe epithelial 1 gamma subunit; Sodium channel nonvoltage-gated 1 gamma (epithelial); sodium channel, non voltage gated 1 gamma subunit; sodium channel, non-voltage-gated 1, gamma subunit; sodium channel, nonvoltage-gated 1, gamma; Sodium channel, nonvoltage-gated 1, gamma (epithelial); sodium channel, nonvoltage-gated, type I, gamma
Gene Aliases: [g]ENaC; BESC3; ENaC; ENaCg; ENaCgamma; PHA1; SCNEG; SCNN1G
UniProt ID: (Human) P51170, (Mouse) Q9WU39, (Rat) P37091
Entrez Gene ID: (Human) 6340, (Mouse) 20278, (Rat) 24768
Molecular Function:
ion channel
transporter
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support