Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence of human SHIP. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807327 |
Synthetic peptide sequence: NEDDKFTVQASEGVSMRFFTKLDQLIEFYKKENMGLVTHLQ.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
This gene is a member of the inositol polyphosphate-5-phosphatase (INPP5) family and encodes a protein with an N-terminal SH2 domain, an inositol phosphatase domain, and two C-terminal protein interaction domains. Expression of this protein is restricted to hematopoietic cells where its movement from the cytosol to the plasma membrane is mediated by tyrosine phosphorylation. At the plasma membrane, the protein hydrolyzes the 5' phosphate from phosphatidylinositol (3,4,5)-trisphosphate and inositol-1,3,4,5-tetrakisphosphate, thereby affecting multiple signaling pathways. Overall, the protein functions as a negative regulator of myeliod cell proliferation and survival. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: hp51CN; Inositol polyphosphate-5-phosphatase 145 kDa; Inositol polyphosphate-5-phosphatase D; Inositol polyphosphate-5-phosphatase of 145 kDa; Inositol polyphosphate-5-phosphatase, 145 kDa; inositol polyphosphate-5-phosphatase, 145kD; inositol polyphosphate-5-phosphatase, 145kDa; MGC104855; MGC142140; MGC142142; OTTHUMP00000165069; OTTHUMP00000165070; OTTHUMP00000165071; OTTHUMP00000165072; OTTHUMP00000203442; p150Ship; phosphatidylin; Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1; Phosphatidylinositol 4,5-bisphosphate 5-phosphatase; phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1; Phosphatidylinositol-4,5-bisphosphate 5-phosphatase; SH2 domain-containing inositol 5'-phosphatase 1; SH2 domain-containing inositol phosphatase 1; SH2 domain-containing inositol-5'-phosphatase 1; SH2-containing inositol phosphatase SHIP; SHIP-1; signaling inositol polyphosphate 5 phosphatase SIP-145; signaling inositol polyphosphate phosphatase SHIP II; SIP-145; Src homology 2 domain-containing inositol-5-phosphatase
Gene Aliases: 7a33; hp51CN; INPP5D; p150Ship; s-SHIP; SHIP; SHIP-1; SHIP1; SIP-145
UniProt ID: (Human) Q92835, (Mouse) Q9ES52, (Rat) P97573
Entrez Gene ID: (Human) 3635, (Mouse) 16331, (Rat) 54259
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support