Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Cell Analysis
    • Antibodies
    • Mass Spectrometry
    • Cell Culture
    • Laboratory Instruments
    • Clinical and Diagnostics
    • Chromatography
    • Laboratory Equipment
    • Laboratory Supplies
    • Molecular Biology and Nucleic Acid Analysis
    • Sequence-Specific Nucleic Acid Products
    • See all product categories
  • Applications
    • Cell Culture and Transfection
    • Flow Cytometry
    • Cancer Research
    • Chromatography
    • Sequencing
    • PCR
    • Lab Solutions
    • Allergy Diagnostics
    • See all applications and techniques
  • Services
    • Instrument Services
    • Cell Biology Services
    • Custom Services
    • Training Services
    • Lab Informatics Services
    • Financial and Leasing Services
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • See all services
  • Help and Support
    • How to Order
    • Promotions and Online Offers
    • Contact Us
    • Change Location
    • Create a New Account
    • See all help and support topics
  • Popular
    • Our Instagram
      Our Instagram
    • Our Facebook
      Our Facebook
    • Blog Behind the Bench
      Blog Behind the Bench
    • Customer Experience Center (CEC)
      Customer Experience Center (CEC)
    • Ecommerce Exclusives
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
          • Primary Antibodies ›
          • SHP2 Antibodies

          Invitrogen

          SHP2 Polyclonal Antibody

          View all (48) SHP2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite SHP2 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (4)
          SHP2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          SHP2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 4

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          SHP2 Antibody (PA5-95299) in IHC (P)

          Immunohistochemistry analysis of SHP2 in paraffin-embedded mouse cardiac muscle tissue. Samples were incubated with SHP2 polyclonal antibody (Product # PA5-95299). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          SHP2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SHP2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SHP2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SHP2 Antibody in Western Blot (WB)
          SHP2 Polyclonal Antibody

          Product Details

          PA5-95299

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807103

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Brain Tissue, Mouse Brain Tissue, Rat Cardiac Muscle Tissue, Mouse Kidney Tissue, HELA whole cell, SW620 whole cell, HEPG2 whole cell, JURKAT whole cell. IHC: mouse cardiac muscle tissue, rat skeletal muscle tissue, human lung cancer tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: 2SH2 domain protein; encodes catalytic domain; HCP; HGNC:9644; MGC14433; Mutations: 351:OK; Noonan syndrome 1; null; OTTHUMP00000166108; protein tyrosine phosphatase SH-PTP2; Protein-tyrosine phosphatase 1D; Protein-tyrosine phosphatase 2C; Protein-tyrosine phosphatase SYP; PTP-1D; PTP-2C; PTP1C; SH-PTP2; SH-PTP2 protein tyrosine phosphatase non-receptor type 11; SH-PTP2 protein tyrosine phosphatase, non-receptor type 11; SH-PTP3; SH2 domain-containing protein tyrosine phosphatase 2; SH2 domain-containing protein tyrosine phosphatase-2; SHP-2; Tyrosine-protein phosphatase non-receptor type 11; unnamed protein product

          View more View less

          Gene Aliases: 2700084A17Rik; AW536184; BPTP3; CFC; JMML; METCDS; NS1; PTP-1D; PTP1D; PTP2C; PTPN11; SAP-2; SH-PTP2; SH-PTP3; SHP-2; SHP2; SHPTP2; Syp

          View more View less

          UniProt ID: (Human) Q06124, (Mouse) P35235, (Rat) P41499

          View more View less

          Entrez Gene ID: (Human) 5781, (Mouse) 19247, (Rat) 25622

          View more View less

          Function(s)
          phosphotyrosine binding phosphoprotein phosphatase activity protein tyrosine phosphatase activity non-membrane spanning protein tyrosine phosphatase activity insulin receptor binding protein binding hydrolase activity protein kinase binding receptor signaling complex scaffold activity receptor tyrosine kinase binding cadherin binding cell adhesion molecule binding peptide hormone receptor binding binding, bridging protein tyrosine kinase binding SH3/SH2 adaptor activity phosphatase activity protein domain specific binding D1 dopamine receptor binding phospholipase binding insulin receptor substrate binding protein phosphatase
          Process(es)
          DNA damage checkpoint neutrophil activation involved in immune response lipid metabolic process triglyceride metabolic process signal transduction epidermal growth factor receptor signaling pathway integrin-mediated signaling pathway axonogenesis brain development heart development fibroblast growth factor receptor signaling pathway hormone-mediated signaling pathway positive regulation of signal transduction cytokine-mediated signaling pathway cerebellar cortex formation platelet formation T cell costimulation positive regulation of lipopolysaccharide-mediated signaling pathway negative regulation of chondrocyte differentiation negative regulation of type I interferon production positive regulation of type I interferon production microvillus organization positive regulation of interferon-beta production positive regulation of tumor necrosis factor production regulation of cell adhesion mediated by integrin negative regulation of cell adhesion mediated by integrin multicellular organism growth organ growth peptidyl-tyrosine dephosphorylation megakaryocyte development atrioventricular canal development ERBB signaling pathway negative regulation of T cell proliferation vasodilation hormone metabolic process glucose homeostasis regulation of protein complex assembly regulation of MAPK cascade positive regulation of ossification positive regulation of mitotic cell cycle positive regulation of glucose import positive regulation of insulin receptor signaling pathway negative regulation of insulin secretion regulation of protein export from nucleus positive regulation of hormone secretion negative regulation of hormone secretion platelet-derived growth factor receptor signaling pathway neurotrophin TRK receptor signaling pathway ephrin receptor signaling pathway genitalia development inner ear development homeostasis of number of cells within a tissue negative regulation of cortisol secretion positive regulation of protein kinase B signaling Bergmann glial cell differentiation negative regulation of growth hormone secretion face morphogenesis regulation of type I interferon-mediated signaling pathway intestinal epithelial cell migration positive regulation of ERK1 and ERK2 cascade cellular response to mechanical stimulus cellular response to epidermal growth factor stimulus positive regulation of intracellular signal transduction negative regulation of neutrophil activation activation of MAPK activity protein dephosphorylation dephosphorylation abortive mitotic cell cycle regulation of multicellular organism growth multicellular organismal reproductive process positive regulation of glucose import in response to insulin stimulus
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Find Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Brasil flag icon
          Brasil

          Your items have has been added!


          Host server : magellan-search-blue-67655d8755-b2k9d:80/100.66.79.173:80.
          git-commit: dddaa802cd395f65bf1581942d0e97a089c38f41
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.46.0-Offline