Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
SHP2 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
PA5-95299
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human SHP2 (69-99aa EKFATLAELVQYYMEHHGQLKEKNGDVIELK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: Rat Brain Tissue, Mouse Brain Tissue, Rat Cardiac Muscle Tissue, Mouse Kidney Tissue, HELA whole cell, SW620 whole cell, HEPG2 whole cell, JURKAT whole cell. IHC: mouse cardiac muscle tissue, rat skeletal muscle tissue, human lung cancer tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains two tandem Src homology-2 domains, which function as phospho-tyrosine binding domains and mediate the interaction of this PTP with its substrates. This PTP is widely expressed in most tissues and plays a regulatory role in various cell signaling events that are important for a diversity of cell functions, such as mitogenic activation, metabolic control, transcription regulation, and cell migration. Mutations in this gene are a cause of Noonan syndrome as well as acute myeloid leukemia.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: encodes catalytic domain; HCP; HGNC:9644; MGC14433; Noonan syndrome 1; null; OTTHUMP00000166108; protein tyrosine phosphatase SH-PTP2; Protein-tyrosine phosphatase 1D; Protein-tyrosine phosphatase 2C; Protein-tyrosine phosphatase SYP; PTP-1D; PTP-2C; PTP1C; SH-PTP2; SH-PTP2 protein tyrosine phosphatase non-receptor type 11; SH-PTP2 protein tyrosine phosphatase, non-receptor type 11; SH-PTP3; SH2 domain-containing protein tyrosine phosphatase-2; SHP-2; Tyrosine-protein phosphatase non-receptor type 11
Gene Aliases: 2700084A17Rik; AW536184; BPTP3; CFC; JMML; METCDS; NS1; PTP-1D; PTP1D; PTP2C; PTPN11; SAP-2; SH-PTP2; SH-PTP3; SHP-2; SHP2; SHPTP2; Syp
UniProt ID: (Human) Q06124, (Mouse) P35235, (Rat) P41499
Entrez Gene ID: (Human) 5781, (Mouse) 19247, (Rat) 25622
phosphoprotein phosphatase activity
protein tyrosine phosphatase activity
non-membrane spanning protein tyrosine phosphatase activity
SH3/SH2 adaptor activity
insulin receptor binding
protein binding
1-phosphatidylinositol-3-kinase activity
protein domain specific binding
receptor tyrosine kinase binding
D1 dopamine receptor binding
phospholipase binding
insulin receptor substrate binding
phosphatidylinositol-4,5-bisphosphate 3-kinase activity
peptide hormone receptor binding
hydrolase activity
phosphatase activity
protein phosphatase
DNA damage checkpoint
activation of MAPK activity
triglyceride metabolic process
epidermal growth factor receptor signaling pathway
integrin-mediated signaling pathway
axonogenesis
brain development
heart development
fibroblast growth factor receptor signaling pathway
hormone-mediated signaling pathway
regulation of phosphatidylinositol 3-kinase signaling
cerebellar cortex formation
platelet activation
platelet formation
T cell costimulation
microvillus organization
abortive mitotic cell cycle
regulation of cell adhesion mediated by integrin
negative regulation of cell adhesion mediated by integrin
multicellular organism growth
organ growth
peptidyl-tyrosine dephosphorylation
megakaryocyte development
phosphatidylinositol-3-phosphate biosynthetic process
atrioventricular canal development
ERBB signaling pathway
regulation of multicellular organism growth
hormone metabolic process
glucose homeostasis
regulation of protein complex assembly
positive regulation of mitotic cell cycle
negative regulation of insulin secretion
regulation of protein export from nucleus
phosphatidylinositol phosphorylation
positive regulation of hormone secretion
platelet-derived growth factor receptor signaling pathway
neurotrophin TRK receptor signaling pathway
ephrin receptor signaling pathway
phosphatidylinositol-mediated signaling
multicellular organismal reproductive process
genitalia development
inner ear development
homeostasis of number of cells within a tissue
leukocyte migration
negative regulation of cortisol secretion
Bergmann glial cell differentiation
negative regulation of growth hormone secretion
face morphogenesis
regulation of type I interferon-mediated signaling pathway
intestinal epithelial cell migration
positive regulation of ERK1 and ERK2 cascade
positive regulation of glucose import in response to insulin stimulus
protein dephosphorylation
lipid metabolic process
positive regulation of signal transduction
dephosphorylation
negative regulation of hormone secretion
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support