Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
SLC12A1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 6
SLC12A1 Antibody (PA5-80003) in IHC (P)
Immunohistochemistry (Paraffin) analysis of NKCC2 in paraffin-embedded section of mouse kidney tissue using SLC12A1 Polyclonal Antibody (Product # PA5-80003). Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody at a 5 µg/mL dilution overnight at 4... View More
Product Details
PA5-80003
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Non-human primate,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1 (52-83aa DEAQKRLRISFRPGNQECYDNFLQSGETAKTD).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: monkey kidney tissue, rat kidney tissue, mouse kidney tissue. IHC: human renal cancer tissue, mouse kidney tissue, rat kidney tissue.
Target Information
The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: BSC1; bumetanide-sensitive cotransporter type 1; Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1; bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2; Kidney-specific Na-K-Cl symporter; MGC48843; mNKCC2; Na-K-2Cl cotransporter; Na-K-2Cl cotransporter 2; NKCC2; NKCC2A variant A; solute carrier family 12 (sodium/potassium/chloride transporter), member 1; solute carrier family 12 (sodium/potassium/chloride transporters), member 1; Solute carrier family 12 member 1; Solute carrier family 12 member 1 (bumetanide-sensitive sodium-[potassium]-chloride cotransporter); Solute carrier family 12, member 1 (bumetanide-sensitive sodium-[potassium]-chloride cotransporter)
Gene Aliases: AI788571; BSC1; D630042G03Rik; mBSC1; NKCC2; SLC12A1; urehr3
UniProt ID: (Human) Q13621, (Mouse) P55014
Entrez Gene ID: (Human) 6557, (Mouse) 20495, (Rat) 25065
transport
ion transport
potassium ion transport
sodium ion transport
diterpenoid metabolic process
protein insertion into membrane from inner side
ion transmembrane transport
chloride transmembrane transport
kidney development
chloride transport
excretion
renal rubidium ion absorption
chemical homeostasis
transmembrane transport
positive regulation of calcineurin-NFAT signaling cascade
cellular hyperosmotic salinity response
cation transmembrane transport
renal sodium ion absorption
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support