Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • NKCC2 Antibodies

          Invitrogen

          SLC12A1 Polyclonal Antibody

          View all (15) NKCC2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite SLC12A1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (6)
          SLC12A1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          SLC12A1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 6

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          SLC12A1 Antibody (PA5-80003) in IHC (P)

          Immunohistochemistry (Paraffin) analysis of NKCC2 in paraffin-embedded section of mouse kidney tissue using SLC12A1 Polyclonal Antibody (Product # PA5-80003). Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody at a 5 µg/mL dilution overnight at 4... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          SLC12A1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SLC12A1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SLC12A1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SLC12A1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SLC12A1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SLC12A1 Antibody in Western Blot (WB)
          SLC12A1 Polyclonal Antibody

          Product Details

          PA5-80003

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.25-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Non-human primate, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1 (52-83aa DEAQKRLRISFRPGNQECYDNFLQSGETAKTD).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2747118

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: monkey kidney tissue, rat kidney tissue, mouse kidney tissue. IHC: human renal cancer tissue, mouse kidney tissue, rat kidney tissue.

          Target Information

          The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: BSC1; bumetanide-sensitive cotransporter type 1; Bumetanide-sensitive sodium-(potassium)-chloride cotransporter 1; bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2; Kidney-specific Na-K-Cl symporter; MGC48843; mNKCC2; Na-K-2Cl cotransporter; Na-K-2Cl cotransporter 2; Na/K/2Cl cotransporter; NKCC2; solute carrier family 12 (sodium/potassium/chloride transporter), member 1; solute carrier family 12 (sodium/potassium/chloride transporters), member 1; Solute carrier family 12 member 1; Solute carrier family 12 member 1 (bumetanide-sensitive sodium-[potassium]-chloride cotransporter); Solute carrier family 12, member 1 (bumetanide-sensitive sodium-[potassium]-chloride cotransporter); unnamed protein product

          View more View less

          Gene Aliases: AI788571; BSC; BSC-1; BSC1; CCC2; D630042G03Rik; mBSC1; NKCC2; SLC12A1; urehr3

          View more View less

          UniProt ID: (Human) Q13621, (Mouse) P55014

          View more View less

          Entrez Gene ID: (Human) 6557, (Mouse) 20495, (Rat) 25065

          View more View less

          Function(s)
          sodium:potassium:chloride symporter activity symporter activity cation:chloride symporter activity transmembrane transporter activity transporter activity protein binding rubidium ion transmembrane transporter activity secondary carrier transporter
          Process(es)
          ion transport potassium ion transport sodium ion transport cell volume homeostasis ion transmembrane transport sodium ion transmembrane transport chloride ion homeostasis potassium ion homeostasis sodium ion homeostasis transmembrane transport chloride transmembrane transport potassium ion import across plasma membrane kidney development transport chloride transport excretion protein insertion into membrane from inner side renal rubidium ion absorption chemical homeostasis positive regulation of calcineurin-NFAT signaling cascade cellular hyperosmotic salinity response cation transmembrane transport diterpenoid metabolic process renal sodium ion absorption
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-blue-744bc48644-454p7:80/100.66.72.101:80.
          git-commit: 747bde55a712f6f97bf7760408d445eefba4e16f
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.0-Offline