Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
Assay-dependent | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN). |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2747130 |
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Organic cation transporters (OCT) are expressed in the plasma membrane of epithelial cells from a wide range of tissues, where they function in the elimination of endogenous amines, cationic drugs and other xenobiotics. The structure of OCTs consists of a 12-transmembrane-domain structure and a large extracellular hydrophilic loop. In humans, OCT1 is primarily expressed in the liver, while OCT2 is expressed in the kidney. OCT3 is expressed in the placenta, skeletal muscle, prostate, aorta and liver. OCT2, also known as SLC22A2, is a multi-specific transporter protein localizing to the basolateral and luminal membranes of the kidney distal tubule and proximal tubules. OCT2 is responsible for mediating the pH-sensitive tubular uptake of organic compounds from circulation. An additional splice variant exists for OCT2, namely OCT2-A.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: 2-Oct; hOCT2; Organic cation transporter 2; rOCT2; solute carrier family 22 (organic cation transporter), member 2; Solute carrier family 22 member 2; solute carrier family 22, member 2
Gene Aliases: OCT2; OCT2r; Orct2; rOCT2; SLC22A2
UniProt ID: (Human) Q5T7Q6, (Rat) Q9R0W2, (Mouse) O70577
Entrez Gene ID: (Human) 6582, (Rat) 29503, (Mouse) 20518
Molecular Function:
secondary carrier transporter
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support