Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Cell Analysis
    • Antibodies
    • Mass Spectrometry
    • Cell Culture
    • Laboratory Instruments
    • Clinical and Diagnostics
    • Chromatography
    • Laboratory Equipment
    • Laboratory Supplies
    • Molecular Biology and Nucleic Acid Analysis
    • Sequence-Specific Nucleic Acid Products
    • See all product categories
  • Applications
    • Cell Culture and Transfection
    • Flow Cytometry
    • Cancer Research
    • Chromatography
    • Sequencing
    • PCR
    • Lab Solutions
    • Allergy Diagnostics
    • See all applications and techniques
  • Services
    • Cell Biology Services
    • Custom Services
    • Training Services
    • Lab Informatics Services
    • Financial and Leasing Services
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Food Safety Inspection Services
    • See all services
  • Help and Support
    • How to Order
    • Promotions and Online Offers
    • Contact Us
    • Change Location
    • Create a New Account
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
          • Primary Antibodies ›
          • SLC22A2 Antibodies

          Invitrogen

          SLC22A2 Polyclonal Antibody

          2 References
          View all (12) SLC22A2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite SLC22A2 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (3)
          SLC22A2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          SLC22A2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 3

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          SLC22A2 Antibody (PA5-80015) in IHC (P)

          Immunohistochemistry analysis of SLC22A2 on paraffin-embedded mouse kidney tissue. Sample was incubated with SLC22A2 polyclonal antibody (Product# PA5-80015). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          SLC22A2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SLC22A2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SLC22A2 Antibody in Western Blot (WB)
          SLC22A2 Polyclonal Antibody

          Product Details

          PA5-80015

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          5 µg/mL
          View 1 publication 1 publication

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunohistochemistry (Frozen) (IHC (F))

          -
          View 1 publication 1 publication
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence in the middle region of human SLC22A2 (524-555aa ETIEEAENMQRPRKNKEKMIYLQVQKLDIPLN).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2747130

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Brain Tissue, Mouse Brain Tissue. IHC: Mouse Kidney Tissue, Rat Kidney Tissue.

          Target Information

          Organic cation transporters (OCT) are expressed in the plasma membrane of epithelial cells from a wide range of tissues, where they function in the elimination of endogenous amines, cationic drugs and other xenobiotics. The structure of OCTs consists of a 12-transmembrane-domain structure and a large extracellular hydrophilic loop. In humans, OCT1 is primarily expressed in the liver, while OCT2 is expressed in the kidney. OCT3 is expressed in the placenta, skeletal muscle, prostate, aorta and liver. OCT2, also known as SLC22A2, is a multi-specific transporter protein localizing to the basolateral and luminal membranes of the kidney distal tubule and proximal tubules. OCT2 is responsible for mediating the pH-sensitive tubular uptake of organic compounds from circulation. An additional splice variant exists for OCT2, namely OCT2-A.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: 2-Oct; hOCT2; mOCT2; Organic cation transporter 2; rOCT2; solute carrier family 22 (organic cation transporter), member 2; Solute carrier family 22 member 2; solute carrier family 22, member 2; unnamed protein product

          View more View less

          Gene Aliases: OCT2; OCT2r; Orct2; rOCT2; SLC22A2

          View more View less

          UniProt ID: (Human) O15244, (Rat) Q9R0W2, (Mouse) O70577

          View more View less

          Entrez Gene ID: (Human) 6582, (Rat) 29503, (Mouse) 20518

          View more View less

          Function(s)
          amine transmembrane transporter activity acetylcholine transmembrane transporter activity neurotransmitter transporter activity monoamine transmembrane transporter activity organic anion transmembrane transporter activity organic cation transmembrane transporter activity prostaglandin transmembrane transporter activity L-amino acid transmembrane transporter activity pyrimidine nucleoside transmembrane transporter activity choline transmembrane transporter activity thiamine transmembrane transporter activity putrescine transmembrane transporter activity efflux transmembrane transporter activity spermidine transmembrane transporter activity quaternary ammonium group transmembrane transporter activity toxin transporter activity transmembrane transporter activity xenobiotic transporter activity L-arginine transmembrane transporter activity steroid binding ion transmembrane transporter activity transporter activity secondary carrier transporter
          Process(es)
          ion transport cation transport neurotransmitter transport serotonin transport body fluid secretion organic cation transport quaternary ammonium group transport prostaglandin transport amine transport putrescine transport spermidine transport acetylcholine transport choline transport dopamine transport norepinephrine transport xenobiotic transport epinephrine transport histamine transport serotonin uptake histamine uptake norepinephrine uptake transmembrane transport thiamine transmembrane transport purine-containing compound transmembrane transport amino acid import across plasma membrane dopamine uptake L-arginine import across plasma membrane export across plasma membrane transport across blood-brain barrier L-alpha-amino acid transmembrane transport spermidine transmembrane transport arginine transmembrane transport cellular detoxification drug transport across blood-brain barrier ion transmembrane transport cation transmembrane transport transport ammonium transmembrane transport
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          • Social Media
          • Contact Us
          • Report a Site Issue
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Argentina flag icon
          Argentina

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-5cvsx:80/100.66.79.163:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline