Invitrogen

SLC7A3 Polyclonal Antibody

View all (6) SLC7A3 antibodies

Datasheet

Protocols

Questions & Answers

Tech Support

Datasheet

Protocols

Questions & Answers

Tech Support

Product Image Gallery

SLC7A3 Antibody in Western Blot (WB) — Western blot analysis of SLC7A3 in Lane 1: human A431 whole cell lysate. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with SLC7A3 polyclonal antibody (Product # PA5-95468) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution of 1:10,000, and developed with enhanced chemiluminescence (ECL).

Product Details

PA5-95468

Applications	Tested Dilution	Publications
Western Blot (WB)	0.1-0.5 µg/mL	-

Product Specifications
Species Reactivity	Human
Host/Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human SLC7A3, different from the related mouse and rat sequences by four amino acids. View immunogen
Conjugate	Unconjugated
Form	Lyophilized
Concentration	500 µg/mL
Purification	Affinity chromatography
Storage buffer	PBS with 4mg trehalose
Contains	0.05mg sodium azide
Storage conditions	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
RRID	AB_2807270

Product Specific Information

Synthetic peptide sequence: 1-30aa, MPWQAFRRFGQKLVRRRTLESGMAETRLAR.

Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.

Target Information

Mediates the uptake of the cationic amino acids arginine, lysine and ornithine in a sodium-independent manner.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?

Let us know so we can reference it here.

Cite this product

Bioinformatics

Protein Aliases: CAT-3; Cationic amino acid transporter 3; Cationic amino acid transporter y+; solute carrier family 7 (cationic amino acid transporter, y+ system), member 3; Solute carrier family 7 member 3

Gene Aliases: ATRC3; CAT-3; CAT3; SLC7A3

UniProt ID: (Human) Q8WY07

Entrez Gene ID: (Human) 84889

Molecular Function: amino acid transporter