Search
Invitrogen
SMC3 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
PA5-80041
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3 (1178-1216aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: Rat Brain Tissue, Rat Liver Tissue, Rat Testis Tissue, HELA whole cell, A549 whole cell, MCF-7 whole cell, NIH3T3 whole cell. IHC: mouse intestine tissue, rat kidney tissue, human intestinal cancer tissue.
Target Information
This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Bamacan; basement membrane chondroitin sulfate proteoglycan; Basement membrane-associated chondroitin proteoglycan; Chondroitin sulfate proteoglycan 6; chondroitin sulfate proteoglycan 6 (bamacan); Chromosome segregation protein SmcD; Chromosome-associated polypeptide; hCAP; Mad member-interacting protein 1; SMC family; SMC protein 3; structural maintenace of chromosomes 3; Structural maintenance of chromosomes protein 3; unnamed protein product
Gene Aliases: BAM; Bamacan; BMH; CDLS3; CSPG6; HCAP; Mmip1; SMC-3; SMC3; SMC3L1; SmcD
UniProt ID: (Human) Q9UQE7, (Mouse) Q9CW03
Entrez Gene ID: (Human) 9126, (Mouse) 13006, (Rat) 29486
nucleotide binding
core promoter proximal region sequence-specific DNA binding
chromatin binding
double-stranded DNA binding
microtubule motor activity
protein binding
ATP binding
ATPase activity
mediator complex binding
protein heterodimerization activity
beta-tubulin binding
dynein complex binding
dynein binding
molecular_function
regulation of DNA replication
DNA repair
cellular response to DNA damage stimulus
cell cycle
sister chromatid cohesion
mitotic sister chromatid cohesion
mitotic nuclear division
meiotic nuclear division
signal transduction
stem cell population maintenance
negative regulation of DNA endoreduplication
chromosome organization
cell division
meiotic cell cycle
mitotic cell cycle
establishment of mitotic sister chromatid cohesion
establishment of meiotic sister chromatid cohesion
mitotic spindle assembly
mitotic spindle organization
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support