Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
            • Instrument Management
          • Primary Antibodies ›
          • SOD2 (MnSOD) Antibodies

          Invitrogen

          SOD2 (MnSOD) Polyclonal Antibody

          View all (36) SOD2 (MnSOD) antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite SOD2 (MnSOD) Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (5)
          SOD2 (MnSOD) Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          SOD2 (MnSOD) Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 5

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          SOD2 (MnSOD) Antibody (PA5-80049) in ICC/IF

          Immunocytochemistry analysis of SOD2 (MnSOD) on SMMC-7721 cells. Antigen retrieval was performed using citrate buffer (pH6, epitope retrieval solution) for 20 mins. Sample was blocked using 10% goat serum, incubated with SOD2 (MnSOD) polyclonal antibody (Product# PA5-80049) with a dilution of 1 µg/mL (overnight at 4°C). Development was performed using Streptavidin-Biotin-Complex (SABC) with DAB chromogen me... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          SOD2 (MnSOD) Antibody in Immunocytochemistry (ICC/IF)
          SOD2 (MnSOD) Antibody in Immunocytochemistry (ICC/IF)
          SOD2 (MnSOD) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SOD2 (MnSOD) Antibody in Western Blot (WB)
          SOD2 (MnSOD) Antibody in Western Blot (WB)
          SOD2 (MnSOD) Polyclonal Antibody

          Product Details

          PA5-80049

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human SOD2 (192-222aa QYKNVRPDYLKAIWNVINWENVTERYMACKK).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2747164

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Human HepG2 whole cell, rat liver tissue, rat lung tissue, mouse liver tissue, mouse lung tissue. IHC: human mammary cancer tissue. ICC/IF: A549 Cell, SMMC-7721 Cell.

          Target Information

          Superoxide dismutase (SOD) is an antioxidant enzyme involved in the defense system against reactive oxygen species (ROS). SOD catalyzes the dismutation reaction of superoxide radical anion (O2) to hydrogen peroxide, which is then catalyzed to innocuous O2 and H2O by glutathione peroxidase and catalase. Several classes of SOD have been identified. These include intracellular copper, zinc SOD (Cu, Zn-SOD/SOD-1), mitochondrial manganese SOD (Mn-SOD/SOD-2) and extracellular Cu, Zn-SOD (EC-SOD/SOD-3). SOD1 is found in all eukaryotic species as a homodimeric 32 kDa enzyme containing one each of Cu and Zn ion per subunit. The manganese containing 80 kDa tetrameric enzyme SOD2, is located in the mitochondrial matrix in close proximity to a primary endogenous source of superoxide, the mitochondrial respiratory chain. SOD3 is a heparin-binding multimer of disulfide-linked dimers, primarily expressed in human lungs, vessel walls and airways. SOD4 is a copper chaperone for superoxide dismutase (CCS), which specifically delivers Cu to copper/zinc superoxide dismutase. CCS may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: epididymis secretory sperm binding protein; gastric cancer-associated lncRNA 1; GC1; GClnc1; indophenoloxidase B; IPO B; IPO-B; IPOB; lncRNA-GC1; manganese SOD; manganese superoxide dismutase; manganese-containing superoxide dismutase; mangano-superoxide dismutase; mitochondrial superoxide dismutase 2; Mn superoxide dismutase; Mn-SOD; Mn-superoxide dismutase; MNSOD; MVCD6; Superoxide dimutase 2, mitochondrial; superoxide dismutase; superoxide dismutase 2, mitochondrial; Superoxide dismutase [Mn], mitochondrial; unnamed protein product

          View more View less

          Gene Aliases: GC1; GClnc1; IPO-B; IPOB; lncRNA-GC1; Mn-SOD; MNSOD; MVCD6; Sod-2; SOD2

          View more View less

          UniProt ID: (Human) P04179, (Rat) P07895, (Mouse) P09671

          View more View less

          Entrez Gene ID: (Human) 6648, (Rat) 24787, (Mouse) 20656

          View more View less

          Function(s)
          DNA binding superoxide dismutase activity protein binding oxidoreductase activity oxygen binding enzyme binding manganese ion binding identical protein binding metal ion binding oxidoreductase metabolite interconversion enzyme
          Process(es)
          response to reactive oxygen species response to superoxide response to hypoxia release of cytochrome c from mitochondria liver development detection of oxygen vasodilation by acetylcholine involved in regulation of systemic arterial blood pressure regulation of transcription from RNA polymerase II promoter glutathione metabolic process superoxide metabolic process response to oxidative stress mitochondrion organization heart development locomotory behavior regulation of blood pressure negative regulation of cell proliferation intrinsic apoptotic signaling pathway in response to DNA damage intrinsic apoptotic signaling pathway in response to oxidative stress apoptotic mitochondrial changes response to xenobiotic stimulus post-embryonic development response to manganese ion response to zinc ion response to selenium ion response to gamma radiation positive regulation of hydrogen peroxide biosynthetic process response to activity removal of superoxide radicals respiratory electron transport chain hemopoiesis positive regulation of cell migration response to nutrient levels oxygen homeostasis response to lipopolysaccharide response to L-ascorbic acid response to silicon dioxide cellular response to oxidative stress response to isolation stress response to immobilization stress vasodilation response to hydrogen peroxide superoxide anion generation hydrogen peroxide metabolic process negative regulation of apoptotic process negative regulation of neuron apoptotic process positive regulation of nitric oxide biosynthetic process negative regulation of fat cell differentiation response to cadmium ion negative regulation of fibroblast proliferation neuron development response to axon injury erythrophore differentiation hydrogen peroxide biosynthetic process protein homotetramerization response to electrical stimulus regulation of mitochondrial membrane potential response to hyperoxia multicellular organismal iron ion homeostasis response to magnetism cellular response to ethanol negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway negative regulation of membrane hyperpolarization negative regulation of vascular smooth muscle cell proliferation positive regulation of vascular associated smooth muscle cell apoptotic process positive regulation of vascular associated smooth muscle cell differentiation involved in phenotypic switching age-dependent response to oxidative stress age-dependent response to reactive oxygen species aging sensory perception of sound response to radiation response to cold response to drug regulation of catalytic activity protein homooligomerization iron ion homeostasis oxidation-reduction process
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-pgj68:80/100.66.79.163:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline