Invitrogen

SOX10 Polyclonal Antibody

Advanced Verification

This Antibody was verified by Relative expression to ensure that the antibody binds to the antigen stated.

View all (31) SOX10 antibodies

Datasheet

Protocols

Questions & Answers

Tech Support

Datasheet

Protocols

Questions & Answers

Tech Support

Product Image Gallery

SOX10 Antibody in Immunocytochemistry (ICC/IF) — Immunofluorescence analysis of SOX10 was performed using 70% confluent log phase A-375 cells. The cells were fixed with 4% paraformaldehyde for 10 minutes, permeabilized with 0.1% Triton™ X-100 for 15 minutes, and blocked with 2% BSA for 1 hour at room temperature. The cells were labeled with SOX10 Polyclonal Antibody (Product # PA5-80053) at 1:100 dilution in 0.1% BSA and incubated overnight at 4 degree and then labeled with Goat anti-Rabbit IgG (H+L) Superclonal™ Recombinant Secondary Antibody, Alexa Fluor® 488 (Product # A27034) at a dilution of 1:2000 for 45 minutes at room temperature (Panel a: green). Nuclei (Panel b: blue) were stained with ProLong™ Diamond Antifade Mountant with DAPI (Product # P36962). F-actin (Panel c: red) was stained with Rhodamine Phalloidin (Product # R415, 1:300). Panel d represents the composite image showing Nuclear localization. Panel e represents control cells with no primary antibody to assess background. The images were captured at 60X magnification..

SOX10 Antibody in Western Blot (WB) — Western blot was performed using Anti-SOX10 Polyclonal Antibody (Product # PA5-80053) and a band at ~58 kDa corresponding to SOX10 was observed in A-375 but not in SW480 which is reported to be negative. Modified whole cell extracts (30 µg lysate) of A-375 (Lane 1) and SW480 (Lane 2) were electrophoresed using Novex® NuPAGE® 4-12% % Bis-Tris gel (Product # NP0322BOX). Resolved proteins were then transferred onto a nitrocellulose membrane (Product # IB23001) by iBlot® 2 Dry Blotting System (Product # IB21001). The blot was probed with the primary antibody (1 µg/mL) and detected by chemiluminescence with Goat anti-Rabbit IgG (H+L) Superclonal™ Recombinant Secondary Antibody, HRP (Product # A27036, 1:4000 dilution) using the iBright FL 1000 (Product # A32752). Chemiluminescent detection was performed using Novex® ECL Chemiluminescent Substrate Reagent Kit (Product # WP20005).

SOX10 Antibody — Antibody specificity was demonstrated by detection of differential basal expression of the target across tissues tested owing to their inherent genetic constitution. Relative expression of SOX10 was observed in A-375 in comparison to SW480 using Anti-SOX10 Polyclonal Antibody (Product # PA5-80053) in Western Blot. {RE}

Product Details

PA5-80053

Applications	Tested Dilution	Publications
Western Blot (WB)	0.1 - 1 µg/mL	-
Immunocytochemistry (ICC/IF)	1:100	-

Product Specifications
Species Reactivity	Human, Mouse, Rat
Host/Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	A synthetic peptide corresponding to a sequence of human SOX10. View antigen
Conjugate	Unconjugated
Form	Lyophilized
Concentration	500 µg/mL
Purification	Antigen affinity chromatography
Storage buffer	PBS with 4mg trehalose
Contains	0.05mg sodium azide
Storage conditions	-20°C
RRID	AB_2747168

Product Specific Information

The synthetic peptide sequence is KPHIDFGNVDIGEISHEVMSNMETFDVAELDQYL

Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.

Target Information

SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?

Let us know so we can reference it here.

Cite this product

Bioinformatics

Protein Aliases: dominant megacolon; dominant megacolon, mouse, human homolog of; MGC15649; Protein SOX-21; SRY; SRY (sex determining region Y)-box 10; SRY box 10; SRY-box containing gene 10; SRY-related HMG-box gene 10; Transcription factor SOX-10; Transcription factor SOX-M

Gene Aliases: DOM; PCWH; Sox-10; SOX10; Sox21; WS2E; WS4; WS4C

UniProt ID: (Human) P56693, (Rat) O55170, (Mouse) Q04888

Entrez Gene ID: (Human) 6663, (Rat) 29361, (Mouse) 20665

Function(s)