Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
SOX10 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 7
SOX10 Antibody (PA5-80053) in ICC/IF
Immunofluorescence analysis of SOX10 was performed using 70% confluent log phase A-375 cells. The cells were fixed with 4% paraformaldehyde for 10 minutes, permeabilized with 0.1% Triton™ X-100 for 15 minutes, and blocked with 2% BSA for 1 hour at room temperature. The cells were labeled with SOX10 Polyclonal Antibody (Product # PA5-80053) at 1:100 dilution in 0.1% BSA and incubated overnight at 4 degree and then labeled with Goat anti-Rabbit IgG (Heavy Chain) Superclonal™ Recombinant Secondary Antibody, Alexa Fluor® 488 (Product # A27034)... View More
Product Details
PA5-80053
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human SOX10 (KPHIDFGNVDIGEISHEVMSNMETFDVAELDQYL).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2747168
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human SH-SY5Y whole cell, human U251 whole cell, human U2OS whole cell, human U87 whole cell, rat brain tissue, rat C6 whole cell, mouse brain tissue, mouse Neuro-2a whole cellIHC: human melanoma tissue, mouse brain tissue.
Target Information
SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: dominant megacolon; dominant megacolon, mouse, human homolog of; MGC15649; Protein SOX-21; SRY; SRY (sex determining region Y)-box 10; SRY box 10; SRY-box containing gene 10; SRY-related HMG-box gene 10; Transcription factor SOX-10; Transcription factor SOX-M
Gene Aliases: DOM; PCWH; Sox-10; SOX10; Sox21; WS2E; WS4; WS4C
UniProt ID: (Human) P56693, (Rat) O55170, (Mouse) Q04888
Entrez Gene ID: (Human) 6663, (Rat) 29361, (Mouse) 20665
RNA polymerase II core promoter proximal region sequence-specific DNA binding
RNA polymerase II distal enhancer sequence-specific DNA binding
transcriptional activator activity, RNA polymerase II transcription factor binding
chromatin binding
transcription factor activity, RNA polymerase II distal enhancer sequence-specific binding
transcription coactivator activity
protein binding
transcription factor binding
identical protein binding
RNA polymerase II transcription factor activity, sequence-specific DNA binding
DNA binding
transcription factor activity, sequence-specific DNA binding
transcription regulatory region DNA binding
in utero embryonic development
neural crest cell migration
positive regulation of neuroblast proliferation
regulation of transcription, DNA-templated
transcription from RNA polymerase II promoter
peripheral nervous system development
positive regulation of gliogenesis
cell differentiation
melanocyte differentiation
lacrimal gland development
negative regulation of apoptotic process
negative regulation of transcription, DNA-templated
positive regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter
cell development
cell maturation
enteric nervous system development
digestive tract morphogenesis
developmental growth
oligodendrocyte differentiation
stem cell differentiation
morphogenesis of a branching epithelium
negative regulation of canonical Wnt signaling pathway
transcription, DNA-templated
regulation of transcription from RNA polymerase II promoter
anatomical structure morphogenesis
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support