Invitrogen
This Antibody was verified by Relative expression to ensure that the antibody binds to the antigen stated.
Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1 - 1 µg/mL | - |
Immunocytochemistry (ICC/IF) |
1:100 | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence of human SOX10. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2747168 |
The synthetic peptide sequence is KPHIDFGNVDIGEISHEVMSNMETFDVAELDQYL
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
SOX10 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. This protein may act as a transcriptional activator after forming a protein complex with other proteins. It acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: dominant megacolon; dominant megacolon, mouse, human homolog of; MGC15649; Protein SOX-21; SRY; SRY (sex determining region Y)-box 10; SRY box 10; SRY-box containing gene 10; SRY-related HMG-box gene 10; Transcription factor SOX-10; Transcription factor SOX-M
Gene Aliases: DOM; PCWH; Sox-10; SOX10; Sox21; WS2E; WS4; WS4C
UniProt ID: (Human) P56693, (Rat) O55170, (Mouse) Q04888
Entrez Gene ID: (Human) 6663, (Rat) 29361, (Mouse) 20665
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support