Synthetic peptide sequence: 114-143aa, KILENAQRFNQAQSGNIQSTVMLDKQKELD.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
STAT1 (signal transducers and activators of transcription 1) is a member of the STAT family of transcription factors. STAT1 can be activated by interferon-alpha, interferon-gamma, EGF, PDGF and IL6. STAT1 is known to regulate several genes which are involved in cell growth, apoptosis, immune responses, and lipid metabolism. Further, STAT1 plays an important role in mediating cell viability in response to different cell stimuli and pathogen exposure. The STAT1 gene is located on chromosome 2. STAT1 is activated to regulate gene expression in response to extracellular signaling polypeptides including cytokines, interferons, and growth factors. After phosphorylation by JAK tyrosine kinases, STAT1 enters the nucleus to regulate transcription of many different genes. Among the seven STATs types, STAT1, STAT3, STAT5a, and STAT5b have a wide activation profile. STAT1 is activated by many different ligands including IFN family (IFN-Alpha, IFN-Beta, IFN-gamma and IL-10), gp130 family (IL-6, IL-11, LIF, CNTF, and G-CSF), and receptor tyrosine kinases (EGF, PDGF, and CSF-1). Two alternatively spliced transcript variants encoding distinct isoforms of STAT1 have been described.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: DKFZp686B04100; OTTHUMP00000165046; OTTHUMP00000205845; signal transducer and activator of transcription 1; signal transducer and activator of transcription 1, 91kD; signal transducer and activator of transcription 1, 91kDa; Signal transducer and activator of transcription 1-alpha/beta; signal transducer and activator of transcription-1; STAT; STAT 1; STAT-1; stat1 alpha; Transcription factor ISGF-3 components p91/p84
Gene Aliases: 2010005J02Rik; AA408197; CANDF7; DD6G4-4; IMD31A; IMD31B; IMD31C; ISGF-3; STAT1; STAT91
UniProt ID: (Human) P42224
Entrez Gene ID: (Human) 6772, (Mouse) 20846, (Rat) 25124
Molecular Function:
nucleic acid binding
transcription factor
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support