Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • STAT1 Antibodies

          Invitrogen

          STAT1 Polyclonal Antibody

          View all (73) STAT1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite STAT1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (2)
          STAT1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          STAT1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          STAT1 Antibody (PA5-95267) in WB

          Western blot analysis of STAT1 using STAT1 Polyclonal Antibody (Product # PA5-95267). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. Lane 1: human Hela whole cell lysates. Lane 2: human MCF-7 whole cell lysates. Lane 3: human SiHa whole cell lysates. Lane 4: human A549 whole cell lysates. Lane 5: rat lung tissue lysates. Lane 6: mouse lung tissue lysates. After electrophoresis, proteins wer... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          STAT1 Antibody in Western Blot (WB)
          STAT1 Antibody in Flow Cytometry (Flow)
          STAT1 Polyclonal Antibody

          Product Details

          PA5-95267

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human STAT1 (114-143aa KILENAQRFNQAQSGNIQSTVMLDKQKELD).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807071

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Hela whole cell, human MCF-7 whole cell, human SiHa whole cell, human A549 whole cell, rat lung tissue, mouse lung tissue. Flow: A549 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          STAT1 (signal transducers and activators of transcription 1) is a member of the STAT family of transcription factors. STAT1 can be activated by interferon-alpha, interferon-gamma, EGF, PDGF and IL6. STAT1 is known to regulate several genes which are involved in cell growth, apoptosis, immune responses, and lipid metabolism. Further, STAT1 plays an important role in mediating cell viability in response to different cell stimuli and pathogen exposure. The STAT1 gene is located on chromosome 2. STAT1 is activated to regulate gene expression in response to extracellular signaling polypeptides including cytokines, interferons, and growth factors. After phosphorylation by JAK tyrosine kinases, STAT1 enters the nucleus to regulate transcription of many different genes. Among the seven STATs types, STAT1, STAT3, STAT5a, and STAT5b have a wide activation profile. STAT1 is activated by many different ligands including IFN family (IFN-Alpha, IFN-Beta, IFN-gamma and IL-10), gp130 family (IL-6, IL-11, LIF, CNTF, and G-CSF), and receptor tyrosine kinases (EGF, PDGF, and CSF-1). Two alternatively spliced transcript variants encoding distinct isoforms of STAT1 have been described.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: DKFZp686B04100; OTTHUMP00000165046; OTTHUMP00000205845; signal transducer and activator of transcription 1; signal transducer and activator of transcription 1, 91kD; signal transducer and activator of transcription 1, 91kDa; Signal transducer and activator of transcription 1-alpha/beta; STAT; STAT 1; STAT-1; stat1 alpha; transcription factor; Transcription factor ISGF-3 components p91/p84; transcription factor; 91 kDa; unnamed protein product

          View more View less

          Gene Aliases: 2010005J02Rik; AA408197; CANDF7; DD6G4-4; IMD31A; IMD31B; IMD31C; ISGF-3; STAT1; STAT91

          View more View less

          UniProt ID: (Human) P42224

          View more View less

          Entrez Gene ID: (Human) 6772, (Mouse) 20846, (Rat) 25124

          View more View less

          Function(s)
          RNA polymerase II regulatory region sequence-specific DNA binding RNA polymerase II core promoter proximal region sequence-specific DNA binding RNA polymerase II core promoter sequence-specific DNA binding RNA polymerase II transcription factor activity, sequence-specific DNA binding transcription corepressor binding transcription coactivator binding DNA binding double-stranded DNA binding transcription factor activity, sequence-specific DNA binding tumor necrosis factor receptor binding protein binding enzyme binding CCR5 chemokine receptor binding histone acetyltransferase binding histone binding identical protein binding protein homodimerization activity sequence-specific DNA binding ubiquitin-like protein ligase binding cadherin binding protein phosphatase 2A binding promoter-specific chromatin binding transcription factor activity, RNA polymerase II core promoter sequence-specific signal transducer activity DNA-binding transcription factor
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter negative regulation of endothelial cell proliferation positive regulation of mesenchymal cell proliferation positive regulation of defense response to virus by host negative regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis regulation of transcription, DNA-templated regulation of transcription from RNA polymerase II promoter defense response signal transduction JAK-STAT cascade response to nutrient blood circulation positive regulation of cell proliferation response to xenobiotic stimulus response to mechanical stimulus negative regulation of angiogenesis positive regulation of interferon-alpha production cellular response to insulin stimulus tumor necrosis factor-mediated signaling pathway response to cytokine response to interferon-gamma response to interferon-beta cellular response to interferon-beta interleukin-7-mediated signaling pathway interleukin-9-mediated signaling pathway regulation of cell proliferation response to hydrogen peroxide regulation of apoptotic process negative regulation of I-kappaB kinase/NF-kappaB signaling response to peptide hormone endothelial cell migration positive regulation of nitric oxide biosynthetic process positive regulation of erythrocyte differentiation positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter positive regulation of JAK-STAT cascade negative regulation by virus of viral protein levels in host cell positive regulation of smooth muscle cell proliferation negative regulation of developmental process response to cAMP defense response to virus interferon-gamma-mediated signaling pathway type I interferon signaling pathway renal tubule development interleukin-27-mediated signaling pathway cellular response to cytokine stimulus cellular response to interferon-gamma metanephric mesenchymal cell proliferation involved in metanephros development metanephric mesenchymal cell differentiation negative regulation of metanephric nephron tubule epithelial cell differentiation receptor signaling pathway via STAT transcription, DNA-templated transcription from RNA polymerase II promoter activation of cysteine-type endopeptidase activity involved in apoptotic process response to bacterium cytokine-mediated signaling pathway lipopolysaccharide-mediated signaling pathway response to lipopolysaccharide negative regulation of macrophage fusion response to drug response to exogenous dsRNA cellular response to lipopolysaccharide response to organic cyclic compound
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-blue-67655d8755-vzwvz:80/100.66.79.173:80.
          git-commit: dddaa802cd395f65bf1581942d0e97a089c38f41
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.46.0-Offline