Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
            • Instrument Management
          • Primary Antibodies ›
          • SULT2A1 Antibodies

          Invitrogen

          SULT2A1 Polyclonal Antibody

          View all (22) SULT2A1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite SULT2A1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (4)
          SULT2A1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          SULT2A1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 4

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          SULT2A1 Antibody (PA5-95329) in IHC (P)

          Immunohistochemistry analysis of SULT2A1 in paraffin-embedded human renal cancer tissue. Samples were incubated with SULT2A1 polyclonal antibody (Product # PA5-95329). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          SULT2A1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SULT2A1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SULT2A1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          SULT2A1 Antibody in Western Blot (WB)
          SULT2A1 Polyclonal Antibody

          Product Details

          PA5-95329

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human SULT2A1 (253-285aa DWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807132

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human hepatocellular carcinoma tumor tissue (HCCT), human hepatocellular carcinoma paracancerous tissue (HCCP), human HepG2 whole cell, rat liver tissue. IHC: mouse liver tissue, rat liver tissue, human renal cancer tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          SULT1 sulfotransferases exhibit N-sulfating activities of carcinogenic heterocyclic amines, and are selective toward phenols, whereas SULT2 enzymes prefer hydroxysteroids and SULT3 family members are selective for N-substituted aryl and alicyclic compounds. SULT2A1 catalyzes the sulfonation of procarcinogen xenobiotics, hydroxysteroids and bile acids, and is highly expressed in adrenal and liver tissues. SULT2A1 plays a role in hepatic cholesterol homeostasis. SULT2B1 consists of two isoforms, SULT2B1a and SULT2B1b, which are transcribed from the same gene by alternative splicing of their first exons. Both isoforms are highly selective for the sulphation of 3b-hydroxysteroids such as pregnenolone, epiandrosterone, DHEA and androstenediol. SULT2B1b is expressed in prostate, skin, placenta and lung.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: alcohol sulfotransferase; alcohol/hydroxysteroid sulfotransferase; Bile salt sulfotransferase; Bile salt sulfotransferase 1; bile-salt sulfotranasferase 2A1; bile-salt sulfotransferase 2A1; Dehydroepiandrosterone sulfotransferase; DHEA-ST; HST; Hydroxysteroid Sulfotransferase; hydroxysteroid sulfotransferase a; ST; ST-20; ST2; ST2A1; Sulfotransferase 2A1; sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA) -preferring, member 1; sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA)-preferring, member 1; sulfotransferase hydroxysteroid gene 2; sulfotransferase, DHEA preferring; sulfotransferase, hydroxysteroid preferring 1; sulfotransferase, hydroxysteroid preferring 2; SULT2A3; unnamed protein product

          View more View less

          Gene Aliases: DHEA-ST; DHEA-ST8; DHEAS; HST; hSTa; mSTa1; Smp-2; ST2; ST2A1; ST2A3; STa; Sta1; STD; Sth1; Sth2; SULT2A1; SULT2A3

          View more View less

          UniProt ID: (Human) Q06520, (Mouse) P52843, (Rat) P15709

          View more View less

          Entrez Gene ID: (Human) 6822, (Mouse) 20859, (Rat) 24912

          View more View less

          Function(s)
          alcohol sulfotransferase activity protein binding sulfotransferase activity transferase activity bile-salt sulfotransferase activity steroid sulfotransferase activity 3'-phosphoadenosine 5'-phosphosulfate binding drug binding transferase
          Process(es)
          ethanol catabolic process lipid metabolic process xenobiotic metabolic process steroid metabolic process cholesterol metabolic process lipid catabolic process bile acid catabolic process thyroid hormone metabolic process 3'-phosphoadenosine 5'-phosphosulfate metabolic process sulfation aging metabolic process response to activity response to insecticide drug metabolic process response to nutrient levels cellular response to vitamin D
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-5cvsx:80/100.66.79.163:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline