Hamburger Menu Button
Thermo Fisher Scientific Logo
登入
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Tubes
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO 和 CRO 服務
    • CDMO 服務
    • 臨床試驗 CRO 服務
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • Register for an Account
    • How to Order
    • Instrument Support
    • Technical Support Centers
    • Learning Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • 快速訂購
          • 登入
            登入
            Don't have an account ? Create Account
            • 帳戶
            • 訂單
            • 訂製產品與專案
          • Primary Antibodies ›
          • Sorcin Antibodies

          Invitrogen

          Sorcin Polyclonal Antibody

          1 Reference
          View all (10) Sorcin antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite Sorcin Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (9)
          Sorcin Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          Sorcin Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 9

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          Sorcin Antibody (PA5-95611) in ICC/IF

          Immunocytochemistry analysis of SRI using anti-SRI antibody (Product # PA5-95611) . SRI was detected in a section of U2OS cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-SRI antibody (Product # PA5-95611) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          Sorcin Antibody in Immunocytochemistry (ICC/IF)
          Sorcin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Sorcin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Sorcin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Sorcin Antibody in Western Blot (WB)
          Sorcin Antibody in Flow Cytometry (Flow)
          Sorcin Antibody in Flow Cytometry (Flow)
          Sorcin Antibody in Flow Cytometry (Flow)
          Sorcin Antibody in Flow Cytometry (Flow)
          Sorcin Polyclonal Antibody

          Product Details

          PA5-95611

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (IHC)

          -
          View 1 publication 1 publication

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunohistochemistry (Frozen) (IHC (F))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          2 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence of human SRI (TVDPQELQKALTTMGFRLSPQAVNSIAKRY).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807413

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human placenta tissue, human U20S whole cell, human A431 whole cell, human PC-3 whole cell, human HL-60 whole cell, human K562 whole cell, human Caco-2 whole cell, rat lung tissue, mouse lung tissue. IHC: human intestinal cancer tissue, human lung cancer tissue, human mammary cancer tissue. ICC/IF: U20S cell. Flow: SiHa cell, U20S cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Sorcin is a 198 amino acid, soluble, resistance-related, calcium-binding cytosolic protein belonging to the penta-EF hand (PEF) family of calcium binding proteins and contains 4 EF-hand calcium-binding motifs. Human Sorcin is known to share 95% sequence identity with hamster Sorcin. It is known to associate with the sarcolemmal proteins Annexin VII, cardiac ryanodine receptors and L-type Ca2+ channels and thus influence the intracellular Ca (2+)-homeostasis. It is also important in the regulation of intracellular Ca2+ cycling and Ca2+ influx pathways in the heart and skeletal muscle during excitation-contraction. It is overproduced in many multi-drug resistance (MDR) cells and regulates cell apoptosis pathways, thus acting as a new MDR marker for prognosis of acute myeloid leukemia (AML) and a good target for anti-MDR drug development.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: 22 kDa protein; calcium binding protein amplified in mutlidrug-resistant cells; CP-22; CP22; H_RG167B05.1; Sorcin; sorcin CP-22; unnamed protein product; V19

          View more View less

          Gene Aliases: 2210417O06Rik; 2900070H08Rik; CP-22; CP22; SCN; Sor; SRI; V19

          View more View less

          UniProt ID: (Human) P30626, (Mouse) Q6P069

          View more View less

          Entrez Gene ID: (Human) 6717, (Mouse) 109552, (Rat) 683667

          View more View less

          Function(s)
          protease binding receptor binding calcium channel regulator activity calcium ion binding protein binding identical protein binding ion channel binding metal ion binding protein heterodimerization activity DNA-binding transcription factor binding protein sequestering activity transcription regulator inhibitor activity calcium-dependent cysteine-type endopeptidase activity repressing transcription factor binding actin or actin-binding cytoskeletal protein
          Process(es)
          calcium ion transport signal transduction negative regulation of heart rate regulation of gene expression regulation of cell communication by electrical coupling regulation of release of sequestered calcium ion into cytosol by sarcoplasmic reticulum positive regulation of release of sequestered calcium ion into cytosol regulation of calcium ion transport negative regulation of cardiac muscle contraction regulation of insulin secretion involved in cellular response to glucose stimulus regulation of cardiac muscle cell contraction regulation of relaxation of muscle regulation of cell communication by electrical coupling involved in cardiac conduction proteolysis positive regulation of insulin secretion involved in cellular response to glucose stimulus cytoplasmic sequestering of transcription factor negative regulation of ryanodine-sensitive calcium-release channel activity regulation of high voltage-gated calcium channel activity negative regulation of transcription regulatory region DNA binding heart development
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-5cvsx:80/100.66.79.163:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline