Invitrogen

Sorcin Polyclonal Antibody

View all (11) Sorcin antibodies

Datasheet

Protocols

Questions & Answers

Tech Support

Datasheet

Protocols

Questions & Answers

Tech Support

Product Image Gallery

Sorcin Antibody in Immunocytochemistry (ICC/IF) — Immunocytochemistry analysis of SRI using anti-SRI antibody (Product # PA5-95611) . SRI was detected in a section of U2OS cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-SRI antibody (Product # PA5-95611) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.

Sorcin Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of Sorcin in paraffin-embedded human intestinal cancer tissues. Antigen retrieval was performed on the tissue using citrate buffer (pH 6, 20 min) and blocked with 10% goat serum. Samples were incubated with Sorcin polyclonal antibody (Product # PA5-95611) at a 1 µg/mL dilution, followed by biotinylated goat anti-rabbit IgG (30 min, 37°C), and developed with Strepavidin-Biotin-Complex and DAB.

Sorcin Antibody in Western Blot (WB) — Western blot analysis of Sorcin in Lane 1: human placenta tissue lysate, Lane 2: human U20S whole cell lysate, Lane 3: human A431 whole cell lysate, Lane 4: human PC-3 whole cell lysate, Lane 5: human HL-60 whole cell lysate, Lane 6: human K562 whole cell lysate, Lane 7: human Caco-2 whole cell lysate, Lane 8: rat lung tissue lysate, Lane 9: mouse lung tissue lysate. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with Sorcin polyclonal antibody (Product # PA5-95611) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution of 1:10,000, and developed with enhanced chemiluminescence (ECL).

Sorcin Antibody in Flow Cytometry (Flow) — Flow Cytometry of Sorcin in U2OS cells (blue line), isotype control rabbit IgG (green line) and unlabeled (red line). Samples were blocked with 10% goat serum, incubated with Sorcin Polyclonal Antibody (Product # PA5-95611) at a dilution of 1 μg (per 1x10^6 cells), followed by DyLight®488 conjugated goat anti-rabbit IgG (for 30 minutes at 20°C) using 5-10 μg (per 1x10^6 cells) dilution.

Product Details

PA5-95611

Applications

Tested Dilution

Publications

Western Blot (WB)

0.1-0.5 µg/mL

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL

Immunohistochemistry (Frozen) (IHC (F))

0.5-1 µg/mL

Immunocytochemistry (ICC/IF)

2 µg/mL

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells

Product Specifications

Species Reactivity

Human, Mouse, Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence of human SRI (TVDPQELQKALTTMGFRLSPQAVNSIAKRY).

View immunogen

Conjugate

Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

0.05mg sodium azide

Storage conditions

Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.

RRID

AB_2807413

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Sorcin is a 198 amino acid, soluble, resistance-related, calcium-binding cytosolic protein belonging to the penta-EF hand (PEF) family of calcium binding proteins and contains 4 EF-hand calcium-binding motifs. Human Sorcin is known to share 95% sequence identity with hamster Sorcin. It is known to associate with the sarcolemmal proteins Annexin VII, cardiac ryanodine receptors and L-type Ca2+ channels and thus influence the intracellular Ca (2+)-homeostasis. It is also important in the regulation of intracellular Ca2+ cycling and Ca2+ influx pathways in the heart and skeletal muscle during excitation-contraction. It is overproduced in many multi-drug resistance (MDR) cells and regulates cell apoptosis pathways, thus acting as a new MDR marker for prognosis of acute myeloid leukemia (AML) and a good target for anti-MDR drug development.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.