Search
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
TAP1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
PA5-80094
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human
Published species
C. elegans
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human TAP1 (438-471aa RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: HELA whole cell, HUT whole cell, SW620 whole cell. IHC: human intestinal cancer tissue.
Target Information
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: ABC transporter, MHC 1; ABP-278; ABP-280; ABP-280 homolog; Antigen peptide transporter 1; AOI; APT1; ATP-binding cassette sub-family B member 2; ATP-binding cassette, sub-family B (MDR/TAP), member 2; beta-filamin; DAAP-57C1.5; FH1; filamin homolog 1; filamin-3; filamin-B; FLJ26666; FLJ41500; FLN-B; FLN1L; LRS1; Peptide supply factor 1; Peptide transporter involved in antigen processing 1; Peptide transporter PSF1; Peptide transporter TAP1; PSF-1; Really interesting new gene 4 protein; RING4; SCT; TABP; tap i; thyroid autoantigen; transporter 1 ATP-binding cassette sub-family B; transporter 1, ATP-binding cassette, sub-family B (MDR/TAP); transporter associated with antigen processing; transporter, ATP-binding cassette, major histocompatibility complex, 1
Gene Aliases: ABC17; ABCB2; APT1; D6S114E; PSF-1; PSF1; RING4; TAP1; TAP1*0102N; TAP1N; Y3
UniProt ID: (Human) Q03518
Entrez Gene ID: (Human) 6890
protein binding
ATP binding
peptide transporter activity
peptide-transporting ATPase activity
MHC class Ib protein binding
MHC class I protein binding
peptide antigen binding
ATPase activity, coupled to transmembrane movement of substances
protein homodimerization activity
ADP binding
TAP1 binding
TAP2 binding
tapasin binding
protein heterodimerization activity
ATP-binding cassette (ABC) transporter
adaptive immune response
antigen processing and presentation of peptide antigen via MHC class I
antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent
antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent
antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent
positive regulation of antigen processing and presentation of peptide antigen via MHC class I
defense response
peptide transport
intracellular transport of viral protein in host cell
antigen processing and presentation of endogenous peptide antigen via MHC class I
protection from natural killer cell mediated cytotoxicity
cytosol to ER transport
transmembrane transport
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support