Search
Invitrogen
TAP2 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
Product Details
PA5-80096
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human TAP2 (611-651aa QKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSR).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: HELA whole cell.
Target Information
The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. This gene is located 7 kb telomeric to gene family member ABCB2. The protein encoded by this gene is involved in antigen presentation. This protein forms a heterodimer with ABCB2 in order to transport peptides from the cytoplasm to the endoplasmic reticulum. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Alternative splicing of this gene produces two products which differ in peptide selectivity and level of restoration of surface expression of MHC class I molecules.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: ABC transporter, MHC 2; Antigen peptide transporter 2; APT2; ATP-binding cassette sub-family B member 3; ATP-binding cassette, sub-family B (MDR/TAP), member 3; Peptide supply factor 2; Peptide transporter involved in antigen processing 2; Peptide transporter PSF2; Peptide transporter TAP2; PSF-2; putative peptide pump; putative; Really interesting new gene 11 protein; RING11; TAP2; transporter 2, ABC (ATP binding cassette); transporter 2, ATP-binding cassette, sub-family B (MDR/TAP); transporter associated with antigen processing; unnamed protein product
Gene Aliases: ABC18; ABCB3; APT2; D6S217E; MHC1D2; PSF-2; PSF2; RING11; TAP2; Y1
UniProt ID: (Human) Q03519
Entrez Gene ID: (Human) 6891
nucleotide binding
protein binding
ATP binding
peptide antigen-transporting ATPase activity
peptide-transporting ATPase activity
ATPase activity
MHC class Ib protein binding
MHC protein binding
peptide antigen binding
metal ion binding
TAP1 binding
tapasin binding
ABC-type transporter activity
peptide transmembrane transporter activity
T cell mediated cytotoxicity
positive regulation of T cell mediated cytotoxicity
response to molecule of bacterial origin
adaptive immune response
immune system process
antigen processing and presentation of exogenous protein antigen via MHC class Ib, TAP-dependent
antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-dependent
antigen processing and presentation of endogenous peptide antigen via MHC class Ib via ER pathway, TAP-dependent
peptide antigen assembly with MHC class I protein complex
protein transport
peptide transport
antigen processing and presentation of endogenous peptide antigen via MHC class I
cytosol to ER transport
peptide antigen transport
transmembrane transport
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support