Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • TAT Antibodies

          Invitrogen

          TAT Polyclonal Antibody

          View all (10) TAT antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite TAT Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          TAT Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          TAT Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          TAT Antibody (PA5-80097) in WB

          Western blot analysis of TAT in rat spleen extract (lane 1), mouse liver extract (lane 2) and A549 whole cell lysate (lane 3). Sample was incubated with TAT polyclonal antibody (Product # PA5-80097) at a dilution of 0.5 µg/mL. Signal development was performed using a chemiluminescence (ECL) kit. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          TAT Antibody in Western Blot (WB)
          TAT Polyclonal Antibody

          Product Details

          PA5-80097

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence in the middle region of human ATTY (169-208aa FSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEK).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2747212

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat spleen tissue, mouse liver tissue, A549 whole cell.

          Target Information

          TAT is a mitochondrial protein tyrosine aminotransferase which is present in the liver and catalyzes the conversion of L-tyrosine into p-hydroxyphenylpyruvate.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: 2.6.1.5; L-tyrosine:2-oxoglutarate aminotransferase; TAT; testis tissue sperm-binding protein Li 34a; Tyrosine aminotransferase; tyrosine aminotransferase, cytosolic; tyrosine transaminase; unnamed protein product

          View more View less

          Gene Aliases: TAT

          View more View less

          UniProt ID: (Human) P17735, (Mouse) Q8QZR1, (Rat) P04694

          View more View less

          Entrez Gene ID: (Human) 6898, (Mouse) 234724, (Rat) 24813

          View more View less

          Function(s)
          catalytic activity L-tyrosine:2-oxoglutarate aminotransferase activity protein binding transaminase activity amino acid binding transferase activity pyridoxal phosphate binding identical protein binding L-phenylalanine:2-oxoglutarate aminotransferase activity transaminase
          Process(es)
          2-oxoglutarate metabolic process cellular amino acid metabolic process glutamate metabolic process L-phenylalanine catabolic process tyrosine catabolic process response to oxidative stress aromatic amino acid family metabolic process aromatic amino acid family catabolic process response to mercury ion response to glucocorticoid response to dexamethasone biosynthetic process response to organic cyclic compound gluconeogenesis
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Spain flag icon
          Spain

          TEST

          Your items have has been added!


          Host server : magellan-search-blue-67655d8755-zsnhf:80/100.66.75.14:80.
          git-commit: dddaa802cd395f65bf1581942d0e97a089c38f41
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.46.0-Offline