Search
Invitrogen
TCP1 Monoclonal Antibody (2E7)
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 6
TCP1 Antibody (MA5-32998) in ICC/IF
Immunocytochemistry analysis of TCP1 alpha using anti-TCP1 alpha antibody (Product # MA5-32998). TCP1 alpha was detected in a section of MCF7 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL mouse anti-TCP1 alpha antibody (Product # MA5-32998) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Mouse IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was countersta... View More
Product Details
MA5-32998
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human
Host/Isotype
Mouse
/ IgG1
Class
Monoclonal
Type
Antibody
Clone
2E7
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human Hela whole cell, human MCF-7 whole cell, human COLO-320 whole cell, human HepG2 whole cell, human A431 whole cell, human HT1080 whole cell. IHC: human lung cancer tissue, human placenta tissue. ICC/IF: MCF7 cell. Flow: HepG2 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
The T Complex Polypeptide 1 (TCP-1) is approximately 60 kDa protein constitutively expressed in almost all eukaryotic cells, and is upregulated during spermatogenesis. It is found in the cytosol as a subunit of a hetero-oligomeric chaperone that is known to be involved in the folding of actin and tubulin. The family of proteins termed chaperonins act to recognize and stabilize polypeptide intermediates during folding, assembly and disassembly, and share many characteristics with Heat Shock Protein 70 (HSP70) including high abundance, induction by environmental stress, and ATPase activity. The chaperonin family includes the mitochondrial HSP60, Escherichia coli GroEL, the plastid Rubisco-subunit binding protein, and the archaebacterial protein TF55. The TCP-1 sequence shows nearly 40% identity to TF55, but only minimal similarity to HSP60 and GroEL.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CCT-alpha; Chaperonin containing T-complex polypeptide 1 subunit 1; t-complex 1 protein; T-complex protein 1 subunit alpha; T-complex protein 1, alpha subunit; tailless complex polypeptide 1; TCP-1-alpha
Gene Aliases: CCT-alpha; CCT1; CCTA; D6S230E; IDDPMGS; TCP-1-alpha; TCP1
UniProt ID: (Human) P17987
Entrez Gene ID: (Human) 6950
protein folding
tubulin complex assembly
binding of sperm to zona pellucida
positive regulation of telomere maintenance via telomerase
protein stabilization
scaRNA localization to Cajal body
positive regulation of establishment of protein localization to telomere
positive regulation of protein localization to Cajal body
positive regulation of telomerase RNA localization to Cajal body
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support