Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
Product Specifications | |
---|---|
Species Reactivity |
Human |
Host/Isotype |
Mouse / IgG1 |
Class |
Monoclonal |
Type |
Antibody |
Clone |
2E7 |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS). |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2802632 |
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
The T Complex Polypeptide 1 (TCP-1) is approximately 60 kDa protein constitutively expressed in almost all eukaryotic cells, and is upregulated during spermatogenesis. It is found in the cytosol as a subunit of a hetero-oligomeric chaperone that is known to be involved in the folding of actin and tubulin. The family of proteins termed chaperonins act to recognize and stabilize polypeptide intermediates during folding, assembly and disassembly, and share many characteristics with Heat Shock Protein 70 (HSP70) including high abundance, induction by environmental stress, and ATPase activity. The chaperonin family includes the mitochondrial HSP60, Escherichia coli GroEL, the plastid Rubisco-subunit binding protein, and the archaebacterial protein TF55. The TCP-1 sequence shows nearly 40% identity to TF55, but only minimal similarity to HSP60 and GroEL.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: CCT-alpha; T-complex protein 1 subunit alpha; T-complex protein 1, alpha subunit; tailless complex polypeptide 1; TCP-1-alpha
Gene Aliases: CCT-alpha; CCT1; CCTA; D6S230E; TCP-1-alpha; TCP1
UniProt ID: (Human) P17987
Entrez Gene ID: (Human) 6950
Molecular Function:
chaperonin
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support