Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
0.5-1 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of human TFPI2. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807247 |
Synthetic peptide sequence: 70-105aa, EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
TFPI2 may play a role in the regulation of plasmin-mediated matrix remodeling. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 has no effect on thrombin.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: Placental protein 5; PP5; PP5FLJ21164; retinal pigment epithelium cell factor 1; TFPI-2; TFPI-2REF1; Tissue factor pathway inhibitor 2
Gene Aliases: AV000670; PP5; PP5/TFPI-2; REF1; TFPI-2; TFPI2
UniProt ID: (Human) P48307, (Mouse) O35536
Entrez Gene ID: (Human) 7980, (Mouse) 21789
Molecular Function:
protease inhibitor
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support