Invitrogen

TFPI2 Polyclonal Antibody

View all (28) TFPI2 antibodies

Datasheet

Protocols

Questions & Answers

Tech Support

Datasheet

Protocols

Questions & Answers

Tech Support

Product Image Gallery

TFPI2 Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of TFPI2 in paraffin-embedded human placenta tissues. Antigen retrieval was performed on the tissue using citrate buffer (pH 6, 20 min) and blocked with 10% goat serum. Samples were incubated with TFPI2 polyclonal antibody (Product # PA5-95444) at a 1 µg/mL dilution, followed by biotinylated goat anti-rabbit IgG (30 min, 37°C), and developed with Strepavidin-Biotin-Complex and DAB.

TFPI2 Antibody in Western Blot (WB) — Western blot analysis of TFPI2 in Lane 1: mouse spleen tissue lysates, Lane 2: HeLa whole cell lysates, Lane 3: human placenta tissue lysates, Lane 4: MCF-7 whole cell lysates. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with TFPI2 polyclonal antibody (Product # PA5-95444) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution of 1:10,000, and developed with enhanced chemiluminescence (ECL).

Product Details

PA5-95444

Applications	Tested Dilution	Publications
Western Blot (WB)	0.1-0.5 µg/mL	-
Immunohistochemistry (Paraffin) (IHC (P))	0.5-1 µg/mL	-

Product Specifications
Species Reactivity	Human, Mouse
Host/Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	A synthetic peptide corresponding to a sequence at the N-terminus of human TFPI2. View immunogen
Conjugate	Unconjugated
Form	Lyophilized
Concentration	500 µg/mL
Purification	Affinity chromatography
Storage buffer	PBS with 4mg trehalose
Contains	0.05mg sodium azide
Storage conditions	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
RRID	AB_2807247

Product Specific Information

Synthetic peptide sequence: 70-105aa, EGNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQ.

Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.

Target Information

TFPI2 may play a role in the regulation of plasmin-mediated matrix remodeling. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 has no effect on thrombin.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?

Let us know so we can reference it here.

Cite this product

Bioinformatics

Protein Aliases: Placental protein 5; PP5; PP5FLJ21164; retinal pigment epithelium cell factor 1; TFPI-2; TFPI-2REF1; Tissue factor pathway inhibitor 2

Gene Aliases: AV000670; PP5; PP5/TFPI-2; REF1; TFPI-2; TFPI2

UniProt ID: (Human) P48307, (Mouse) O35536

Entrez Gene ID: (Human) 7980, (Mouse) 21789

Molecular Function: protease inhibitor