Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
            • Instrument Management
          • Primary Antibodies ›
          • TGF beta-2 Antibodies

          Invitrogen

          TGF beta-2 Polyclonal Antibody

          View all (13) TGF beta-2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite TGF beta-2 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (2)
          TGF beta-2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          TGF beta-2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          TGF beta-2 Antibody (PA5-80117) in IHC (P)

          Immunohistochemical analysis of TGF beta 2 in paraffin-embedded section of human lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/mL rabbit anti-TGF beta 2 antibody (Product # PA5-80117) overnight at 4°C. Biotinylated goat anti-... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          TGF beta-2 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          TGF beta-2 Antibody in Western Blot (WB)
          TGF beta-2 Polyclonal Antibody

          Product Details

          PA5-80117

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence of human TGF beta 2 (ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPK).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2747232

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human HCCT tissue, huamn HCCP tissue. IHC: human lung cancer tissue.

          Target Information

          Transforming Growth Factor (TGF) betas mediate many cell to cell interactions that occur during embryonic development. Three TGF betas have been identified in mammals. TGF beta 1, TGF beta 2 and TGF beta 3 are each synthesized as precursor proteins that are very similar in that each is cleaved to yield a 112 amino acid polypeptide that remains associated with the latent portion of the molecule. The TGF beta polypeptides are multifunctional; capable of influencing cell proliferation, differentiation, and other functions in a wide range of cell types. Transformed, as well as nonneoplastic tissues, release transforming growth factors; and essentially all mammalian cells possess a specific TGF receptor. The multi modal nature of TGF beta is seen in its ability to stimulate or inhibit cellular proliferation. In general, cells of mesenchymal origin appear to be stimulated by TGF beta whereas cells of epithelial or neuroectodermal origin are inhibited by the peptide. TGF beta 1, TGF beta 2, and TGF beta 1.2 appear to be equivalent in biological activity, although there does appear to be differences in binding to certain types of receptors. TGF beta 2 is produced by many cell types and has been found in the highest concentration in porcine platelets and mammalian bone. Latent TGF beta 2 is the prominent isoform found in body fluids such as amniotic fluid, breast milk, and the aqueous and vitreous humor of the eye.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: BSC-1 cell growth inhibitor; Cetermin; G-TSF; Glioblastoma-derived T-cell suppressor factor; polyergin; prepro-transforming growth factor beta-2; TGFB; TGFβ2; Transforming growth factor; Transforming growth factor beta-2 proprotein; transforming growth factor-beta-2 precursor; unnamed protein product

          View more View less

          Gene Aliases: G-TSF; LDS4; TGF-beta2; TGFB2

          View more View less

          UniProt ID: (Human) P61812

          View more View less

          Entrez Gene ID: (Human) 7042

          View more View less

          Function(s)
          beta-amyloid binding receptor binding type II transforming growth factor beta receptor binding cytokine activity transforming growth factor beta receptor binding protein binding growth factor activity type III transforming growth factor beta receptor binding protein homodimerization activity
          Process(es)
          cell morphogenesis skeletal system development cartilage condensation blood vessel development eye development response to hypoxia kidney development epithelial to mesenchymal transition neural tube closure hair follicle development blood vessel remodeling heart morphogenesis outflow tract septum morphogenesis membranous septum morphogenesis outflow tract morphogenesis heart valve morphogenesis atrioventricular valve morphogenesis pulmonary valve morphogenesis endocardial cushion morphogenesis cardiac right ventricle morphogenesis ventricular trabecula myocardium morphogenesis endocardial cushion fusion atrial septum primum morphogenesis neural retina development activation-induced cell death of T cells transforming growth factor beta receptor signaling pathway axon guidance sensory organ development salivary gland morphogenesis heart development positive regulation of cell proliferation negative regulation of cell proliferation glial cell migration male gonad development response to wounding embryo development ending in birth or egg hatching cardioblast differentiation positive regulation of gene expression negative regulation of gene expression positive regulation of epithelial cell migration positive regulation of epithelial to mesenchymal transition negative regulation of macrophage cytokine production striated muscle tissue development cell migration negative regulation of angiogenesis signaling hemopoiesis extracellular matrix organization collagen fibril organization positive regulation of cell growth negative regulation of cell growth embryonic limb morphogenesis neutrophil chemotaxis epithelial cell differentiation hair follicle morphogenesis response to progesterone positive regulation of stress-activated MAPK cascade regulation of transforming growth factor beta2 production regulation of actin cytoskeleton organization positive regulation of cell adhesion mediated by integrin ascending aorta morphogenesis wound healing regulation of cell proliferation dopamine biosynthetic process odontogenesis uterine wall breakdown regulation of apoptotic process positive regulation of apoptotic process positive regulation of neuron apoptotic process cell-cell junction organization positive regulation of cell differentiation positive regulation of integrin biosynthetic process positive regulation of Notch signaling pathway positive regulation of cell cycle positive regulation of heart contraction negative regulation of Ras protein signal transduction somatic stem cell division embryonic digestive tract development neuron fate commitment neuron development generation of neurons inner ear development negative regulation of epithelial cell proliferation positive regulation of protein secretion positive regulation of immune response positive regulation of cellular component organization positive regulation of multicellular organismal process positive regulation of cell division regulation of timing of catagen positive regulation of catagen positive regulation of cardioblast differentiation positive regulation of protein kinase B signaling cardiac muscle cell proliferation uterus development cardiac epithelial to mesenchymal transition face morphogenesis positive regulation of SMAD protein import into nucleus ventricular septum morphogenesis atrial septum morphogenesis negative regulation of cartilage development pharyngeal arch artery morphogenesis secondary palate development positive regulation of cardiac epithelial to mesenchymal transition positive regulation of activation-induced cell death of T cells cellular response to growth factor stimulus positive regulation of extracellular matrix disassembly extrinsic apoptotic signaling pathway extrinsic apoptotic signaling pathway in absence of ligand transforming growth factor beta receptor superfamily signaling pathway positive regulation of protein localization to nucleus regulation of apoptotic process involved in outflow tract morphogenesis positive regulation of pri-miRNA transcription from RNA polymerase II promoter regulation of extracellular matrix organization regulation of complement-dependent cytotoxicity substantia propria of cornea development pericyte cell differentiation cranial skeletal system development negative regulation of epithelial to mesenchymal transition involved in endocardial cushion formation positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation positive regulation of extrinsic apoptotic signaling pathway in absence of ligand
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-blue-67655d8755-b2k9d:80/100.66.79.173:80.
          git-commit: dddaa802cd395f65bf1581942d0e97a089c38f41
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.46.0-Offline