Invitrogen

TPR Polyclonal Antibody

Product Image Gallery

TPR Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of TPR in paraffin-embedded human lung cancer tissues. Antigen retrieval was performed on the tissue using citrate buffer (pH 6, 20 min) and blocked with 10% goat serum. Samples were incubated with TPR polyclonal antibody (Product # PA5-95533) at a 1 µg/mL dilution, followed by biotinylated goat anti-rabbit IgG (30 min, 37°C), and developed with Strepavidin-Biotin-Complex and DAB.

TPR Antibody in Immunohistochemistry (IHC) — Immunofluorescence analysis of TPR in human intestinal cancer tissues. Antigen retrieval was performed on the tissue using citrate buffer (pH 6, 20 min) and blocked with 10% goat serum. Samples were incubated with TPR polyclonal antibody (Product # PA5-95533) at a 1 µg/mL dilution, followed by 488 conjugated goat anti-rabbit IgG using a 1:100 dilution and DAPI.

TPR Antibody in Western Blot (WB) — Western blot analysis of TPR in Lane 1: human HeLa whole cell lysates, Lane 2: human SW620 whole cell lysates, Lane 3: human MDA-MB-231 whole cell lysates. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with TPR polyclonal antibody (Product # PA5-95533) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution of 1:10,000, and developed with enhanced chemiluminescence (ECL).

Product Details

PA5-95533

Applications	Tested Dilution	Publications
Western Blot (WB)	0.1-0.5 µg/mL	-
Immunohistochemistry (Paraffin) (IHC (P))	0.5-1 µg/mL	-
Immunohistochemistry (Frozen) (IHC (F))	0.5-1 µg/mL	-
Immunocytochemistry (ICC/IF)	2 µg/mL	-
Flow Cytometry (Flow)	1-3 µg/1x10^6 cells	-

Product Specifications
Species Reactivity	Human, Mouse, Rat
Host/Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	A synthetic peptide corresponding to a sequence of human TPR. View antigen
Conjugate	Unconjugated
Form	Lyophilized
Concentration	500 µg/mL
Purification	Affinity chromatography
Storage buffer	PBS with 4mg trehalose
Contains	0.05mg sodium azide
Storage conditions	Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
RRID	AB_2807335

Product Specific Information

Synthetic peptide sequence: MLQAEKKLLEEDVKRWKARNQHLVSQQKD.

Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.

Target Information

Steroidogenic factor-1 (SF-1) regulates multiple genes involved in the adrenal and gonadal development and in the biosynthesis of a variety of hormones, including adrenal and gonadal steroids, anti-Mullerian hormone (AMH), and gonadotropins. SF-1 belongs to the fushi tarazu factor-1 (FTZ-F1) subfamily of orphan nuclear receptors. In the adult ovary, SF-1 localizes to theca/interstitial cells.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?

Let us know so we can reference it here.

Cite this product

Bioinformatics

Protein Aliases: Megator; NPC-associated intranuclear protein; nuclear pore complex-associated protein TPR; Nucleoprotein TPR; translocated promoter region (to activated MET oncogene); Translocated promoter region and nuclear basket protein; Translocated promoter region protein; tumor potentiating region

Gene Aliases: 2610029M07Rik; C77892; TPR

UniProt ID: (Human) P12270, (Mouse) F6ZDS4

Entrez Gene ID: (Human) 7175, (Mouse) 108989, (Rat) 304862

Molecular Function: primary active transporter