Invitrogen

TPR Polyclonal Antibody

Product Image Gallery

TPR Antibody in Immunofluorescence (IF) — Immunofluorescence analysis of TPR in human intestinal cancer tissues. Antigen retrieval was performed on the tissue using citrate buffer (pH 6, 20 min) and blocked with 10% goat serum. Samples were incubated with TPR polyclonal antibody (Product # PA5-95533) at a 1 µg/mL dilution, followed by 488 conjugated goat anti-rabbit IgG using a 1:100 dilution and DAPI.

TPR Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of TPR in paraffin-embedded human lung cancer tissues. Antigen retrieval was performed on the tissue using citrate buffer (pH 6, 20 min) and blocked with 10% goat serum. Samples were incubated with TPR polyclonal antibody (Product # PA5-95533) at a 1 µg/mL dilution, followed by biotinylated goat anti-rabbit IgG (30 min, 37°C), and developed with Strepavidin-Biotin-Complex and DAB.

TPR Antibody in Western Blot (WB) — Western blot analysis of TPR in Lane 1: human HeLa whole cell lysates, Lane 2: human SW620 whole cell lysates, Lane 3: human MDA-MB-231 whole cell lysates. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with TPR polyclonal antibody (Product # PA5-95533) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution of 1:10,000, and developed with enhanced chemiluminescence (ECL).

Product Details

Tested Applications

Dilution

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells

Immunocytochemistry (ICC)

0.5-1 µg/mL

Immunofluorescence (IF)

0.5-1 µg/mL

Immunohistochemistry (Frozen) (IHC (F))

0.5-1 µg/mL

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL

Western Blot (WB)

0.1-0.5 µg/mL

Product Specifications

Species Reactivity

Human, Mouse, Rat

Host / Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence of human TPR.

Conjugate

Unconjugated

Form

Lyophilized

Purification

Affinity chromatography

Storage buffer

0.2mg sodium phosphate with 4mg trehalose, 0.9mg NaCl

Contains

0.05mg sodium azide

Storage conditions

Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.

Product Specific Information

Synthetic peptide sequence: MLQAEKKLLEEDVKRWKARNQHLVSQQKD.

Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 ug/ml.

Target Information

Steroidogenic factor-1 (SF-1) regulates multiple genes involved in the adrenal and gonadal development and in the biosynthesis of a variety of hormones, including adrenal and gonadal steroids, anti-Mullerian hormone (AMH), and gonadotropins. SF-1 belongs to the fushi tarazu factor-1 (FTZ-F1) subfamily of orphan nuclear receptors. In the adult ovary, SF-1 localizes to theca/interstitial cells.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Bioinformatics

Protein Aliases: Megator; NPC-associated intranuclear protein; nuclear pore complex-associated protein TPR; Nucleoprotein TPR; TPR; translocated promoter region (to activated MET oncogene); translocated promoter region and nuclear basket protein; Translocated promoter region protein; tumor potentiating region

Gene Aliases: 2610029M07Rik; C77892

Entrez Gene ID: (Human) 7175, (Mouse) 108989, (Rat) 304862

Function(s)