Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence of human TPR. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 4mg trehalose |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807335 |
Synthetic peptide sequence: MLQAEKKLLEEDVKRWKARNQHLVSQQKD.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Steroidogenic factor-1 (SF-1) regulates multiple genes involved in the adrenal and gonadal development and in the biosynthesis of a variety of hormones, including adrenal and gonadal steroids, anti-Mullerian hormone (AMH), and gonadotropins. SF-1 belongs to the fushi tarazu factor-1 (FTZ-F1) subfamily of orphan nuclear receptors. In the adult ovary, SF-1 localizes to theca/interstitial cells.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: Megator; NPC-associated intranuclear protein; nuclear pore complex-associated protein TPR; Nucleoprotein TPR; translocated promoter region (to activated MET oncogene); Translocated promoter region and nuclear basket protein; Translocated promoter region protein; tumor potentiating region
Gene Aliases: 2610029M07Rik; C77892; TPR
UniProt ID: (Human) P12270, (Mouse) F6ZDS4
Entrez Gene ID: (Human) 7175, (Mouse) 108989, (Rat) 304862
Molecular Function:
primary active transporter
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support