Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Cell Analysis
    • Antibodies
    • Mass Spectrometry
    • Cell Culture
    • Laboratory Instruments
    • Clinical and Diagnostics
    • Chromatography
    • Laboratory Equipment
    • Laboratory Supplies
    • Molecular Biology and Nucleic Acid Analysis
    • Sequence-Specific Nucleic Acid Products
    • See all product categories
  • Applications
    • Cell Culture and Transfection
    • Flow Cytometry
    • Cancer Research
    • Chromatography
    • Sequencing
    • PCR
    • Lab Solutions
    • Allergy Diagnostics
    • See all applications and techniques
  • Services
    • Cell Biology Services
    • Custom Services
    • Training Services
    • Lab Informatics Services
    • Financial and Leasing Services
    • Partnering and Licensing Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Food Safety Inspection Services
    • See all services
  • Help and Support
    • How to Order
    • Promotions and Online Offers
    • Contact Us
    • Change Location
    • Create a New Account
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Special Offers
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
          • Primary Antibodies ›
          • TREX1 Antibodies

          Invitrogen

          TREX1 Polyclonal Antibody

          View all (24) TREX1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite TREX1 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (1)
          TREX1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          TREX1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          TREX1 Antibody (PA5-95313) in WB

          Western blot analysis of TREX1 in SMMC whole cell lysate (40 µg). Samples were incubated with TREX1 polyclonal antibody (Product # PA5-95313) using a 0.5 µg/mL dilution. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          TREX1 Antibody in Western Blot (WB)
          TREX1 Polyclonal Antibody

          Product Details

          PA5-95313

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence in the middle region of human TREX1 (156-185aa DDNLANLLLAFLRRQPQPWCLVAHNGDRYD).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807116

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: SMMC whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Trex1 (ATRIP) is the major human 3' to 5' exonuclease which is required for checkpoint signaling after DNA damage. It is ubiquitously expressed, binds to single stranded DNA coated with replication protein A that accumulates at sites of DNA damage and recruits the ataxia telangiectasia and Rad3 related protein (ATR), a checkpoint kinase, to sites of DNA damage and replication stress. Trex1 is required for ATR expression. This gene uses two different open reading frames. The upstream ORF encodes proteins which interact with ATR and localize to intranuclear foci induced by DNA damage and are essential components of the DNA damage checkpoint. The downstream ORF encodes proteins with 3' to 5' exonuclease activity and may be a subunit of human DNA polymerase III. Multiple transcript variants encoding different isoforms have been found. Mutations in this gene result in Aicardi-Goutieres syndrome, chilblain lupus, and Cree encephalitis.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: 3' repair exonuclease 1; 3'-5' exonuclease TREX1; Deoxyribonuclease III; DNase III; Three-prime repair exonuclease 1; TREX1; unnamed protein product

          View more View less

          Gene Aliases: AGS1; CRV; DRN3; HERNS; RVCLS; TREX1

          View more View less

          UniProt ID: (Human) Q9NSU2

          View more View less

          Entrez Gene ID: (Human) 11277

          View more View less

          Function(s)
          magnesium ion binding nucleic acid binding DNA binding double-stranded DNA binding single-stranded DNA binding nuclease activity exonuclease activity exodeoxyribonuclease activity protein binding 3'-5'-exodeoxyribonuclease activity DNA binding, bending double-stranded DNA 3'-5' exodeoxyribonuclease activity 3'-5' exonuclease activity hydrolase activity MutLalpha complex binding MutSalpha complex binding adenyl deoxyribonucleotide binding identical protein binding protein homodimerization activity metal ion binding WW domain binding
          Process(es)
          DNA damage checkpoint blood vessel development kidney development adaptive immune response organ or tissue specific immune response activation of immune response macrophage activation involved in immune response lymphoid progenitor cell differentiation immune response in brain or nervous system inflammatory response to antigenic stimulus T cell antigen processing and presentation regulation of immunoglobulin production heart morphogenesis heart process atrial cardiac muscle tissue development generation of precursor metabolites and energy regulation of glycolytic process DNA metabolic process DNA replication DNA repair mismatch repair DNA modification DNA catabolic process DNA recombination inflammatory response immune response cellular response to DNA damage stimulus determination of adult lifespan response to UV regulation of gene expression regulation of fatty acid metabolic process regulation of metabolic process mitotic G1 DNA damage checkpoint transposition, RNA-mediated regulation of type I interferon production regulation of tumor necrosis factor production cellular response to oxidative stress cellular response to reactive oxygen species cellular response to UV cellular response to interferon-beta apoptotic cell clearance regulation of cellular respiration innate immune response regulation of innate immune response establishment of protein localization negative regulation of innate immune response regulation of lipid biosynthetic process regulation of inflammatory response protein stabilization regulation of T cell activation defense response to virus type I interferon signaling pathway negative regulation of type I interferon-mediated signaling pathway regulation of protein complex stability cellular response to type I interferon cellular response to gamma radiation cellular response to hydroxyurea immune complex formation cGAS/STING signaling pathway negative regulation of cGAS/STING signaling pathway DNA synthesis involved in UV-damage excision repair regulation of lysosome organization
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          • Social Media
          • Contact Us
          • Report a Site Issue
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Responsibility Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Chile flag icon
          Chile

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-8dsbr:80/100.66.76.150:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline