Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the N-terminus of human UBA1, different from the related mouse and rat sequences by one amino acid. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807149 |
Synthetic peptide sequence: 102-139aa, HDQGTAQWADLSSQFYLREEDIGKNRAEVSQPRLAELN.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
UBE1 catalyzes the first step in ubiquitin conjugation to mark cellular proteins for degradation. This gene complements an X-linked mouse temperature-sensitive defect in DNA synthesis, and thus may function in DNA repair. It is part of a gene cluster on chromosome Xp11. 23. Alternative splicing results in 2 transcript variants encoding the same protein, but with different 5' UTR.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: A1S9 protein; A1S9T and BN75 temperature sensitivity complementing; POC20 centriolar protein homolog; Protein A1S9; testicular secretory protein Li 63; uba1 {ECO:0000312|EMBL:AAH85791.1, ECO:0000312|RGD:1359327}; UBA1, ubiquitin-activating enzyme E1 homolog A; Ubiquitin-activating enzyme E1; Ubiquitin-activating enzyme E1 X; ubiquitin-activating enzyme E1 {ECO:0000250|UniProtKB:Q02053}; ubiquitin-activating enzyme E1, Chr X; ubiquitin-like modifier activating enzyme 1; Ubiquitin-like modifier-activating enzyme 1; Ubiquitin-like modifier-activating enzyme 1 X; ubiquitin-like modifier-activating enzyme 1 {ECO:0000250|UniProtKB:Q02053}
Gene Aliases: A1S9; A1S9T; A1ST; AMCX1; CFAP124; GXP1; POC20; Sbx; SMAX2; UBA1; UBA1A; Ube-1; UBE1; Ube1ax; UBE1X
UniProt ID: (Human) P22314, (Mouse) Q02053, (Rat) Q5U300
Entrez Gene ID: (Human) 7317, (Mouse) 22201, (Rat) 314432
Molecular Function:
ubiquitin-protein ligase
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support