Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Clinical Genomics
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Custom Products & Projects
            • Instrument Management
          • Primary Antibodies ›
          • UCP2 Antibodies

          Invitrogen

          UCP2 Polyclonal Antibody

          Advanced Verification
          1 Published Figure
          3 References
          View all (14) UCP2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite UCP2 Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (2)
          • Published Figures (1)
          • Advanced Verification (1)
          UCP2 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          UCP2 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 4

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          UCP2 Antibody (PA5-80203) in WB

          Western blot analysis of UCP2 in Lane 1: rat spleen tissue lysate, Lane 2: rat cardiac muscle tissue lysate, Lane 3: rat brain tissue lysate, Lane 4: mouse spleen tissue lysate, Lane 5: mouse cardiac muscle tissue lysate, Lane 6: mouse brain tissue lysate, Lane 7: human HeLa whole cell lysate using 50 µg (reducing conditions) per well. Electrophoresis was performed on 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours and protein was transferred to a nitrocellulose membrane at 150mA for 50-90 minutes. Sample was b... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          UCP2 Antibody in Western Blot (WB)
          UCP2 Antibody in Western Blot (WB)
          UCP2 Antibody in Western Blot (WB)
          UCP2 Antibody
          UCP2 Polyclonal Antibody

          Product Details

          PA5-80203

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          View 2 publications 2 publications

          Miscellaneous PubMed (Misc)

          -
          View 1 publication 1 publication
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Human, Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence in the middle region of human UCP2 (134-170aa AQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREE).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2747317

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: rat spleen tissue, rat cardiac muscle tissue, rat brain tissue, mouse spleen tissue, mouse cardiac muscle tissue, mouse brain tissue, human Hela whole cell.

          Target Information

          UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. UCP2 gene is expressed in many tissues, with the greatest expression in skeletal muscle. UCP2 is thought to play a role in non shivering thermogenesis, obesity and diabetes.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: Dicarboxylate carrier SLC25A8; Dicarboxylate carrier UCP2; Mitochondrial uncoupling protein 2; Solute carrier family 25 member 8; UCP 2; UCPH; uncoupling protein; uncoupling protein 2 (mitochondrial, proton carrier); Uncoupling protein 2, mitochondrial

          View more View less

          Gene Aliases: BMIQ4; SLC25A8; UCP2; UCPH

          View more View less

          UniProt ID: (Human) P55851, (Rat) P56500, (Mouse) P70406

          View more View less

          Entrez Gene ID: (Human) 7351, (Rat) 54315, (Mouse) 22228

          View more View less

          Function(s)
          protein binding secondary active sulfate transmembrane transporter activity hydrogen ion transmembrane transporter activity chloride transmembrane transporter activity oxaloacetate transmembrane transporter activity malate transmembrane transporter activity L-aspartate transmembrane transporter activity antiporter activity oxidative phosphorylation uncoupler activity GDP binding protein homodimerization activity phosphate ion uniporter activity molecular_function transporter secondary carrier transporter
          Process(es)
          mitochondrial fission response to superoxide response to hypoxia glycolytic process glutamine metabolic process mitochondrial transport response to cold response to glucose inorganic anion transport C4-dicarboxylate transport long-chain fatty acid transport macrophage differentiation cellular response to insulin stimulus cellular response to hormone stimulus cellular response to amino acid starvation negative regulation of apoptotic process negative regulation of neuron apoptotic process regulation of mitochondrial membrane potential transmembrane transport negative regulation of insulin secretion involved in cellular response to glucose stimulus response to fatty acid L-aspartate transmembrane transport cellular response to lead ion cellular response to glucose stimulus malate transmembrane transport response to dexamethasone reactive oxygen species metabolic process liver regeneration negative regulation of calcium import into the mitochondrion positive regulation of cold-induced thermogenesis oxaloacetate(2-) transmembrane transport sulfate transmembrane transport chloride transmembrane transport hydrogen ion transmembrane transport mitochondrial transmembrane transport adaptive thermogenesis female pregnancy aging positive regulation of cell death transport
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Hong Kong flag icon
          Hong Kong

          Your items have has been added!


          Host server : magellan-search-blue-67655d8755-x75fr:80/100.66.77.4:80.
          git-commit: dddaa802cd395f65bf1581942d0e97a089c38f41
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.46.0-Offline