Search
Invitrogen
UHRF1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 7
UHRF1 Antibody (PA5-80205) in ICC/IF
Immunocytochemistry analysis of UHRF1 using anti-UHRF1 antibody (Product # PA5-80205) . UHRF1 was detected in a section of U2OS cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-UHRF1 antibody (Product # PA5-80205) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. V... View More
Product Details
PA5-80205
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human UHRF1 (14-51aa HTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQ).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human 293T whole cell, human T47D whole cell, human A549 whole cell, human HepG2 whole cell, human MDA-MB-453 whole cell, human Raji whole cell. IHC: human intestinal cancer tissue. ICC/IF: U20S cell. Flow: U20S cell, A431 cell.
Target Information
This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Multiple transcript variants encoding different isoforms have been found for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Ac2-121; E3 ubiquitin-protein ligase UHRF1; FLJ21925; Hnp95 Huhrf1; hUHRF1; HuNp95; inverted CCAAT box binding protein 90; Inverted CCAAT box-binding protein of 90 kDa; MGC138707; nuclear phosphoprotein 95; nuclear protein 95; Nuclear zinc finger protein Np95; RING finger protein 106; RING-type E3 ubiquitin transferase UHRF1; thymus and cell proliferation associated protein; Transcription factor ICBP90; ub; Ubiquitin-like PHD and RING finger domain-containing protein 1; unnamed protein product
Gene Aliases: hNP95; hUHRF1; huNp95; ICBP90; NP95; RNF106; TDRD22; UHRF1
UniProt ID: (Human) Q96T88
Entrez Gene ID: (Human) 29128
core promoter proximal region sequence-specific DNA binding
nucleic acid binding
DNA binding
ubiquitin-protein transferase activity
protein binding
zinc ion binding
methyl-CpG binding
transferase activity
histone binding
identical protein binding
hemi-methylated DNA-binding
metal ion binding
ubiquitin protein ligase activity
histone H3K9me2/3 reader activity
DNA damage sensor activity
histone H3 ubiquitin ligase activity
negative regulation of transcription from RNA polymerase II promoter
double-strand break repair via homologous recombination
DNA repair
chromatin organization
ubiquitin-dependent protein catabolic process
response to stress
cellular response to DNA damage stimulus
protein ubiquitination
heterochromatin assembly
reciprocal DNA recombination
regulation of gene expression, epigenetic
hypermethylation of CpG island
positive regulation of transcription from RNA polymerase II promoter
regulation of epithelial cell proliferation
positive regulation of protein metabolic process
protein autoubiquitination
mitotic spindle assembly
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support