Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human UNC5C, identical to the related mouse and rat sequences. |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
RRID |
AB_2807135 |
Synthetic peptide sequence: 894-930aa, DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin; they are transmembrane proteins containing 2 immunoglobulin -like domains and 2 type I thrombospondin motifs in the extracellular region.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: Netrin receptor UNC5C; Protein unc-5 homolog 3; Protein unc-5 homolog C; Rostral cerebellar malformation protein; UNC-5 homolog 3; unc-5 homolog C; unc5 (C.elegans homolog) c; unc5 homolog 3
Gene Aliases: B130051O18Rik; Rcm; UNC5C; UNC5H3
UniProt ID: (Human) O95185, (Mouse) O08747, (Rat) Q761X5
Entrez Gene ID: (Human) 8633, (Mouse) 22253, (Rat) 362049
Molecular Function:
transmembrane signal receptor
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support