Invitrogen

Villin Polyclonal Antibody

View all (27) Villin antibodies

Questions & Answers

Tech Support

Questions & Answers

Tech Support

Product Image Gallery

Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of Villin on paraffin-embedded human intestinal cancer tissue. Sample was incubated with Villin polyclonal antibody (Product# PA5-80221).

Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of Villin on paraffin-embedded mouse intestine tissue. Sample was incubated with Villin polyclonal antibody (Product# PA5-80221).

Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of Villin on paraffin-embedded rat intestine tissue. Sample was incubated with Villin polyclonal antibody (Product# PA5-80221).

Villin Antibody in Western Blot (WB) — Western blot was performed using Anti-Villin Polyclonal Antibody(Product # PA5-80221) and a 92kDa band corresponding to Villin was observed across cell lines and tissues tested. Whole cell extracts (30 µg lysate) of Caco-2 (Lane 1), COLO 205 (Lane 2) and PANC-1 (Lane 3) as seen in Fig (a). Tissue extracts Mouse Liver (Lane 1), Mouse Colon (Lane 2) and Mouse Jejunum (Lane 3) as seen in Fig (b) were electrophoresed using NuPAGE™ 4-12% Bis-Tris Protein Gel (Product # NP0321BOX). Resolved proteins were then transferred onto a Nitrocellulose membrane (Product # IB23001) by iBlot® 2 Dry Blotting System (Product # IB21001). The blot was probed with the primary antibody (0.5ug/ml) and detected by chemiluminescence with Goat anti-Rabbit IgG (H+L) Superclonal™ Recombinant Secondary Antibody, HRP (Product # A27036, 1:4000 dilution) using the iBright FL 1000 (Product # A32752). Chemiluminescent detection was performed using Novex® ECL Chemiluminescent Substrate Reagent Kit (Product # WP20005).

Villin Antibody in Western Blot (WB) — Western blot analysis of Villin in Lane 1: rat Intestine tissue lysate, Lane 2: mouse kidney tissue lysate, Lane 3: RH35 whole cell lysate, Lane 4: HEPG2 whole cell lysate, Lane 5: MCF-7 whole cell lysate using 40-50 µg per well. Sample was incubated with Villin (Product # PA5-80221) at a dilution of 0.5 µg/mL.

Villin Antibody — Antibody specificity was demonstrated by detection of differential basal expression of the target across cell lines and tissues tested owing to their inherent genetic constitution. Relative expression of Villin was observed High in Caco-2, COLO 205 and low in PANC-1 as seen in Fig (a). Relative expression of Villin was observed in High in Mouse Jejunum and Low in Mouse Liver and Mouse colon as seen in Fig (b) using Anti-Villin Polyclonal Antibody (Product # PA5-80221) in Western Blot.( Ref :http://dx.doi.org/10.1016/j.cbpa.2016.08.016, https://doi.org/10.1371/journal.pone.0084221). {RE}

Product Details

PA5-80221

Applications	Tested Dilution	Publications
Western Blot (WB)	0.1-0.5 µg/mL	-
Immunohistochemistry (Paraffin) (IHC (P))	2 µg/mL	-
Flow Cytometry (Flow)	1-3 µg/1x10^6 cells	-

Product Specifications
Species Reactivity	Human, Mouse, Rat
Host/Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	A synthetic peptide corresponding to a sequence at the C-terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT).
Conjugate	Unconjugated
Form	Lyophilized
Concentration	500 µg/mL
Purification	Antigen affinity chromatography
Storage buffer	PBS with 5mg BSA
Contains	0.05mg sodium azide
Storage conditions	-20°C
RRID	AB_2747335

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Villin is part of cytoskeleton associated with the microvillar actin core bundle of gastrointestinal and renal brush border. It can interact with actin in a Ca2+ and phosphoinositide-regulated manner. Villin is a very specific marker for adenocarcinomas of the gastrointestinal tract and the pancreas. It is also expressed in some Merkel cell tumor and adenocarcinoma of the lung, prostate, ovarian and kidney.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?

Let us know so we can reference it here.

Cite this product

Bioinformatics

Protein Aliases: OTTHUMP00000207159; Villin-1

Gene Aliases: D2S1471; VIL; VIL1

UniProt ID: (Human) P09327, (Mouse) Q62468

Entrez Gene ID: (Human) 7429, (Mouse) 22349, (Rat) 316521

Molecular Function: non-motor actin binding protein

intestinal D-glucose absorption protein complex assembly apoptotic process epidermal growth factor receptor signaling pathway regulation of cell shape response to bacterium positive regulation of epithelial cell migration actin filament polymerization actin filament depolymerization positive regulation of cell migration positive regulation of actin filament depolymerization epithelial cell differentiation positive regulation of actin filament bundle assembly regulation of microvillus length cellular response to hepatocyte growth factor stimulus positive regulation of multicellular organism growth negative regulation of cysteine-type endopeptidase activity involved in apoptotic process actin nucleation actin filament severing barbed-end actin filament capping regulation of actin nucleation actin filament capping cytoplasmic actin-based contraction involved in cell motility regulation of wound healing cellular response to epidermal growth factor stimulus positive regulation of establishment of protein localization to plasma membrane terminal web assembly regulation of lamellipodium morphogenesis positive regulation of lamellipodium morphogenesis cytoskeleton organization microvillus assembly biological_process

Process(es)

calcium ion binding protein binding phosphatidylinositol-4,5-bisphosphate binding lysophosphatidic acid binding identical protein binding protein homodimerization activity cysteine-type endopeptidase inhibitor activity involved in apoptotic process actin filament binding actin binding metal ion binding molecular_function