Search Thermo Fisher Scientific
Search Thermo Fisher Scientific
Applications | Tested Dilution | Publications |
---|---|---|
Western Blot (WB) |
0.1-0.5 µg/mL | - |
Immunohistochemistry (Paraffin) (IHC (P)) |
2 µg/mL | - |
Flow Cytometry (Flow) |
1-3 µg/1x10^6 cells | - |
Product Specifications | |
---|---|
Species Reactivity |
Human, Mouse, Rat |
Host/Isotype |
Rabbit / IgG |
Class |
Polyclonal |
Type |
Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence at the C-terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT). |
Conjugate |
Unconjugated |
Form |
Lyophilized |
Concentration |
500 µg/mL |
Purification |
Antigen affinity chromatography |
Storage buffer |
PBS with 5mg BSA |
Contains |
0.05mg sodium azide |
Storage conditions |
-20°C |
RRID |
AB_2747335 |
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Villin is part of cytoskeleton associated with the microvillar actin core bundle of gastrointestinal and renal brush border. It can interact with actin in a Ca2+ and phosphoinositide-regulated manner. Villin is a very specific marker for adenocarcinomas of the gastrointestinal tract and the pancreas. It is also expressed in some Merkel cell tumor and adenocarcinoma of the lung, prostate, ovarian and kidney.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: OTTHUMP00000207159; Villin-1
Gene Aliases: D2S1471; VIL; VIL1
UniProt ID: (Human) P09327, (Mouse) Q62468
Entrez Gene ID: (Human) 7429, (Mouse) 22349, (Rat) 316521
Molecular Function:
non-motor actin binding protein
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support