Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Promotions
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Order Status
          • Quick Order
          • Promos
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central
          • Primary Antibodies ›
          • Villin Antibodies

          Invitrogen

          Villin Polyclonal Antibody

          Advanced Verification
          View all (58) Villin antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Datasheet
          Certificates
          Protocols
          Questions & Answers

          Cite Villin Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (17)
          • Advanced Verification (1)
          Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 18

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          Villin Antibody (PA5-80221) in IHC (P)

          Immunohistochemistry (Paraffin) analysis of Villin in paraffin-embedded section of mouse ileum organoid tissue using Villin Polyclonal Antibody (Product # PA5-80221). Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody at a 5 µg/mL di... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Villin Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Villin Antibody in Western Blot (WB)
          Villin Antibody in Western Blot (WB)
          Villin Antibody in Flow Cytometry (Flow)
          Villin Antibody
          Villin Polyclonal Antibody

          Product Details

          PA5-80221

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human Villin (770-799 aa EQLVNKPVEELPEGVDPSRKEEHLSIEDFT).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2747335

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Intestine Tissue, Mouse Kidney Tissue, RH35 whole cell, HEPG2 whole cell, MCF-7 whole cell. IHC: mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue. Flow: CACO-2 cell.

          Target Information

          Villin is part of cytoskeleton associated with the microvillar actin core bundle of gastrointestinal and renal brush border. It can interact with actin in a Ca2+ and phosphoinositide-regulated manner. Villin is a very specific marker for adenocarcinomas of the gastrointestinal tract and the pancreas. It is also expressed in some Merkel cell tumor and adenocarcinoma of the lung, prostate, ovarian and kidney.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: OTTHUMP00000207159; unnamed protein product; Villin-1

          View more View less

          Gene Aliases: D2S1471; VIL; VIL1

          View more View less

          UniProt ID: (Human) P09327, (Mouse) Q62468

          View more View less

          Entrez Gene ID: (Human) 7429, (Mouse) 22349, (Rat) 316521

          View more View less

          Function(s)
          actin binding calcium ion binding protein binding phosphatidylinositol-4,5-bisphosphate binding lysophosphatidic acid binding identical protein binding protein homodimerization activity cysteine-type endopeptidase inhibitor activity involved in apoptotic process actin filament binding metal ion binding molecular_function non-motor actin binding protein
          Process(es)
          intestinal D-glucose absorption apoptotic process cytoskeleton organization actin filament organization epidermal growth factor receptor signaling pathway actin polymerization or depolymerization regulation of cell shape response to bacterium positive regulation of epithelial cell migration actin filament polymerization actin filament depolymerization positive regulation of cell migration positive regulation of actin filament depolymerization epithelial cell differentiation positive regulation of actin filament bundle assembly regulation of microvillus length cellular response to hepatocyte growth factor stimulus positive regulation of multicellular organism growth positive regulation of cellular component biogenesis actin filament severing barbed-end actin filament capping regulation of actin nucleation actin filament capping cytoplasmic actin-based contraction involved in cell motility regulation of wound healing protein-containing complex assembly cellular response to epidermal growth factor stimulus positive regulation of lamellipodium organization terminal web assembly positive regulation of protein localization to plasma membrane regulation of lamellipodium morphogenesis positive regulation of lamellipodium morphogenesis microvillus assembly negative regulation of cysteine-type endopeptidase activity involved in apoptotic process actin nucleation positive regulation of establishment of protein localization to plasma membrane biological_process
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us About Us
          • Careers Careers
          • Investors Investors
          • News News
          • Social Responsibility Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy Consumer Health Data Privacy Policy
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Notice
          • Price & Freight Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-green-6b469b8bb7-p58g2:80/100.66.72.198:80.
          git-commit: a334af76dff23450325448aedefe62379591458a
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.48.1-2026.04.16-1.0