Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign In
Don't have an account ? Create Account
  • Applications
    • Real-Time PCR
    • Oligos, Primers, Probes and Genes
    • Cloning
    • Protein Biology
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Cell Analysis
    • Mass Spectrometry
    • Chromatography
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Online Order
    • Custom Primers & TaqMan Probes
    • miRNA Mimics & Inhibitors
    • Stealth RNAi / siRNA
    • Silencer Select siRNAs
    • Custom DNA Oligos
    • GeneArt Services
    • GeneArt Strings DNA Fragments
    • TrueGuide CRISPR gRNA
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • See all online orderable products
  • Services
    • Custom Services
    • Instrument Qualification Services
    • Technical Services
    • Pipette Services
    • Sample Request
    • Instrument Maintenance Services
    • Repairs and Relocation Services
    • OEM and Licensing Services
    • Events, Seminars, Training
    • Unity Lab Services
    • See all services
  • Support
    • Catalogs
    • Application Notes
    • Safety Data Sheets
    • Legal and Regulatory
    • Certificates of Analysis Search
    • Nunc/Nalgene Product Certificates
    • e-learning
    • FAQs
    • Learning Centers
    • Technical Support Centers
    • See all help and support topics
  • Who We Serve
    • Biotech
    • Biopharma
    • CDMO
    • Lab Diagnostics
    • Industrial and Applied Sciences
  • Contact Us
  • Quick Order
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search

Search All
Search button
          • Contact Us
          • Quick Order
          • Sign In
            Sign In
            Don't have an account ? Create Account
            • Connect Your Lab
            • Custom Products & Projects
            • Instrument Management
          • Primary Antibodies ›
          • WNT7A Antibodies

          Invitrogen

          WNT7A Polyclonal Antibody

          2 Published Figures
          1 Reference
          View all (7) WNT7A antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support
          Datasheet
          Certificates
          Protocols
          Questions & Answers
          Tech Support

          Cite WNT7A Polyclonal Antibody

          Additional Information:
          {{banner.description}}
          {{$ctrl.isSkuNotesCollapsed ? 'View more' : 'View less'}}
          • Antibody Testing Data (2)
          • Published Figures (2)
          WNT7A Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          WNT7A Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 4

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          WNT7A Antibody (PA5-80231) in WB

          Western blot analysis of WNT7A using WNT7A Polyclonal Antibody (Product # PA5-80231). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. Lane 1: human hepatocellular carcinoma tumor tissue (HCCT) lysates. Lane 2: human hepatocellular carcinoma paracancerous tissue (HCCP) lysates. Lane 3: rat kidney tissue lysates. Lane 4: rat liver tissue lysates. Lane 5: mouse kidney tissue lysates. Lane 6: mo... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          WNT7A Antibody in Western Blot (WB)
          WNT7A Antibody in Flow Cytometry (Flow)
          WNT7A Antibody in Western Blot (WB)
          WNT7A Antibody in Western Blot (WB)
          WNT7A Polyclonal Antibody

          Product Details

          PA5-80231

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          View 1 publication 1 publication

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Published species

          Mouse

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK).
          3D Epitope / Immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Amount

          100 µg

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2747345

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human hepatocellular carcinoma tumor tissue (HCCT), human hepatocellular carcinoma paracancerous tissue (HCCP)rat kidney tissue, rat liver tissue, mouse kidney tissue, mouse liver tissue. Flow: PC-3 cell.

          Target Information

          Wnt-7a belongs to the Wnt family of signaling proteins that play a key role in maintaining the integrity of embryonic and adult tissues. It is expressed in placenta, kidney, testis, uterus, fetal lung, and fetal and adult brain. Most Wnt proteins can signal though a mechanism called the canonical Wnt pathway, in which Wnt proteins bind to and activate seven-pass transmembrane receptors of the Frizzled family, ultimately leading to the disruption of β-catenin degradation. Intracellular accumulation of β-catenin increases translocation of the protein into the nucleus, where it binds to TCF/LEF transcription factors to induce the expression of numerous genes. Increased Wnt/β-catenin signaling is associated with tumorigenesis in a diverse set of human cancers. However, Wnt-7a/Frizzled-9 signaling has been shown to act as a tumor suppressor in non-small cell lung cancers.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          Bioinformatics

          Protein Aliases: postaxial hemimelia; Protein Wnt-7a; proto-oncogene Wnt7a protein; wingless-related MMTV integration site 7A; wingless-type MMTV integration site 7A; wingless-type MMTV integration site family, member 7A; WNT7a

          View more View less

          Gene Aliases: AI849442; px; SANTOS; tw; Wnt-7a; WNT7A

          View more View less

          UniProt ID: (Human) O00755, (Mouse) P24383

          View more View less

          Entrez Gene ID: (Human) 7476, (Rat) 114850, (Mouse) 22421

          View more View less

          Function(s)
          receptor binding frizzled binding cytokine activity protein binding receptor agonist activity intercellular signal molecule
          Process(es)
          embryonic axis specification cartilage condensation angiogenesis chondrocyte differentiation apoptotic process neurotransmitter secretion axonogenesis synapse assembly sex differentiation positive regulation of cell proliferation tissue development dorsal/ventral pattern formation positive regulation of endothelial cell migration positive regulation of gene expression skeletal muscle satellite cell activation skeletal muscle satellite cell maintenance involved in skeletal muscle regeneration Wnt signaling pathway cerebellar granule cell differentiation cell proliferation in forebrain central nervous system vasculogenesis establishment of cell polarity cell differentiation neuron differentiation embryonic limb morphogenesis regulation of axon diameter response to estradiol somatic stem cell population maintenance embryonic forelimb morphogenesis embryonic hindlimb morphogenesis wound healing, spreading of epidermal cells non-canonical Wnt signaling pathway synaptic vesicle recycling regulation of cell proliferation embryonic digit morphogenesis negative regulation of apoptotic process response to estrogen cell fate commitment asymmetric protein localization involved in cell fate determination positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter positive regulation of JNK cascade somatic stem cell division animal organ development system development stem cell development regulation of epithelial cell proliferation negative regulation of neurogenesis regulation of axonogenesis synapse organization cartilage development positive regulation of protein metabolic process positive regulation of synapse assembly positive regulation of epithelial cell proliferation involved in wound healing uterus development oviduct development canonical Wnt signaling pathway Wnt signaling pathway, planar cell polarity pathway limb development establishment of blood-brain barrier dendritic spine morphogenesis uterus morphogenesis secondary palate development lens fiber cell development cellular response to transforming growth factor beta stimulus presynapse assembly postsynapse assembly regulation of postsynapse organization excitatory synapse assembly positive regulation of excitatory synapse assembly positive regulation of protein localization to presynapse regulation of presynapse assembly regulation of synaptic vesicle exocytosis positive regulation of excitatory postsynaptic potential asymmetric protein localization forelimb morphogenesis hindlimb morphogenesis Wnt signaling pathway involved in wound healing, spreading of epidermal cells wound healing skin morphogenesis reproductive structure development skeletal system morphogenesis palate development positive regulation of canonical Wnt signaling pathway signal transduction cell-cell signaling multicellular organism development organ morphogenesis positive regulation of receptor activity
          It has to be done as per old AB suggested Products section.

          Disclaimer

          Close

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Online Orderable Products
          • Privacy Policy for Online Ordering
          • Act on Specified Commercial Transactions
          • About Returns
          • About Displayed Prices
          • About Shipping Fees
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Study information disclosure
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Seminars
          • Blog
          About Thermo Fisher Plus Icon Minus Icon
          • Corporate Information
          • Social Responsibility (CSR)
          • Enhancing Customer Experience
          • Careers Careers
          • News
          • Trademarks
          • Policies and Notices
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Policy
          © 2006-2026 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          Japan flag icon
          Japan

          Your items have has been added!


          Host server : magellan-search-green-b49b87d85-hznln:80/100.66.79.29:80.
          git-commit: 5b8c860b7cdb41e9cfe07630520f6b51e109d38e
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.47.0-Offline