Search
Search
Invitrogen
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
The synthetic peptide sequence is 174-208aa, QWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQ
Add 0.2 mL of distilled water, will yield a concentration of 500 µg/mL.
The XPA (xeroderma pigmentosumgroup A) protein specifically recognizes the UV-orchemically damaged DNA lesions, and triggers thenucleotide excision repair process. XPA binds to thereplication protein A (RPA) or the excision repaircross complementing 1 protein (ERCC 1). In the absence of nucleotide excision repair persisting (unrepaired) DNA lesions (adducts) may lead to the accumulation of gene mutations and ultimately to cancer. Xeroderma pigmentosum patients have a >2000 fold increased risk to develop skin cancer atsun-exposed areas.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support