Synthetic peptide sequence: 102-139aa, HVLEKDGRFHLRVFMEAVLPNGRVDVAQDATLICPKPD.
Reconstitution information: Add 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Protein Aliases: epididymis luminal protein 163; mgc87693; Processed zona pellucida sperm-binding protein 1; Zona pellucida glycoprotein 1; zona pellucida glycoprotein 1 (sperm receptor); Zona pellucida sperm-binding protein 1; Zp-1; zp1 protein
Gene Aliases: HEL163; OOMD; OOMD1; ZP1
UniProt ID: (Human) P60852, (Rat) O54766
Entrez Gene ID: (Human) 22917, (Rat) 85271
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn moreGet expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support