Search
Invitrogen
GFI1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Additional Information:
{{banner.description}}
FIGURE: 1 / 2
GFI1 Antibody (PA5-79305) in IHC (P)
Immunohistochemistry analysis of GFI1 on paraffin-embedded human mammary cancer tissue. Antigen retrieval was performed using citrate buffer (pH6, epitope retrieval solution) for 20 mins. Sample was blocked using 10% goat serum, incubated with GFI1 polyclonal antibody (Product# PA5-79305) with a dilution of 1 µg/mL (overnight at 4°C), and followed by biotinylated goat anti-rabbit IgG (30 minutes at 37°C). D... View More
Please note: We are reviewing Western blot images included in the antibody testing data in our catalog, including those provided by third parties. Unless expressly labeled or annotated as “raw-unedited”, Western blot images included in the antibody testing data in our catalog may have been edited, optimized or otherwise adjusted for presentation.
Product Details
PA5-79305
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human GFI1 (NLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQH).
Conjugate
Unconjugated
Unconjugated
Unconjugated
Form
Lyophilized
Concentration
500 µg/mL
Amount
100 µg
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - IHC: human mammary cancer tissue, human rectal cancer tissue.
Target Information
GFI1 is a nuclear zinc finger (ZF) transcriptional repressor that plays an important role in hematopoiesis and inner ear development, and has been implicated in lymphomagenesis. The Gfi1 protein expression is regulated by the ubiquitin-proteasome system. It is reported that ubiquitin ligase Triad1 interacts with the DNA-binding domain of Gfi-1. Gfi-1 represses transcription by directly binding to the consensus DNA sequence in the promoters of its target genes. Deficiency of Gfi-1 causes neutropenia and an accumulation of granulomonocytic precursor cells that is reminiscent of a myelodysplastic syndrome in mice.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: FLJ94509; growth factor independence-1; growth factor independent 1 transcription repressor; growth factor independent protein 1; Growth factor independent-1; unnamed protein product; zinc finger protein 163
Gene Aliases: GFI-1; GFI1A; Pal-1; Pal1; SCN2; ZNF163
UniProt ID: (Human) Q99684, (Mouse) P70338, (Rat) Q07120
Entrez Gene ID: (Human) 2672, (Mouse) 14581, (Rat) 24388
transcription regulatory region sequence-specific DNA binding
RNA polymerase II core promoter proximal region sequence-specific DNA binding
transcriptional repressor activity, RNA polymerase II transcription regulatory region sequence-specific binding
transcription factor activity, sequence-specific DNA binding
protein binding
enzyme-substrate adaptor activity
sequence-specific double-stranded DNA binding
bacterial-type RNA polymerase transcriptional repressor activity, sequence-specific DNA binding
negative regulation of transcription from RNA polymerase II promoter
double-strand break repair via homologous recombination
regulation of transcription from RNA polymerase II promoter
cellular response to DNA damage stimulus
mechanosensory behavior
negative regulation of cell fate specification
negative regulation of vitamin D biosynthetic process
negative regulation of neuron projection development
regulation of toll-like receptor signaling pathway
inner ear morphogenesis
auditory receptor cell differentiation
positive regulation of cell fate specification
cell fate commitment
negative regulation of transcription, DNA-templated
positive regulation of interleukin-6-mediated signaling pathway
cellular response to lipopolysaccharide
negative regulation of double-strand break repair via homologous recombination
biological_process
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support